FlyBase Allele Report: Dmel\Pten[117]

General Information

Symbol

Dmel\Pten¹¹⁷

Species

D. melanogaster

Name

FlyBase ID

FBal0120658

Feature type

allele

Associated gene

Dmel\Pten

Associated Insertion(s)

Carried in Construct

Also Known As

PTEN^2L117, dPTEN¹¹⁷

Key Links

Allele class

loss of function allele

Mutagen

Nature of the Allele

Allele class

loss of function allele

(Oldham et al., 2002)

Mutagen

Progenitor genotype

Cytology

Description

5bp deletion producing a frameshift at amino acid position 165 resulting in the insertion of 35 new codons (AYKGPKRCDNPISASICSVFFQTSLFKCSIFESKP) before the new stop codon located in the catalytic domain.

(Oldham et al., 2002)

Mutations Mapped to the Genome

Curation Data

Type

Location

Additional Notes

References

Variant Molecular Consequences

Associated Sequence Data

DDBJ / EMBL / GenBank

DNA sequence

Protein sequence

UniProtKB/Swiss-Prot

UniProtKB/TrEMBL

Expression Data

Reporter Expression

Additional Information

Statement

Reference

Marker for

Reflects expression of

Reporter construct used in assay

Human Disease Associations

Disease Ontology (DO) Annotations

Models Based on Experimental Evidence ( 1 )

Disease

Evidence

References

model of cancer

CEA

(Han et al., 2021)

CEA with Pten^2L100

(Ganguly et al., 2021)

Modifiers Based on Experimental Evidence ( 0 )

Disease

Interaction

References

Comments on Models/Modifiers Based on Experimental Evidence ( 0 )

Disease-implicated variant(s)

Phenotypic Data

Phenotypic Class

abnormal neuroanatomy | adult stage | somatic clone

(Luo et al., 2020)

abnormal neuroanatomy | adult stage | somatic clone, with Scer\GAL4^repo.PU

(Read et al., 2009)

abnormal stress response (with Pten^2L100)

(Oldham et al., 2002)

increased body size (with Pten^2L100)

(Oldham et al., 2002)

increased body size | adult stage (with Pten^2L100)

(Nowak et al., 2013)

increased body size | larval stage (with Pten^2L100)

(Nowak et al., 2013)

increased body size | larval stage | nutrition conditional (with Pten^2L100)

(Nowak et al., 2013)

increased body size | pupal stage (with Pten^2L100)

(Ganguly et al., 2021)

increased body size | recessive | somatic clone

(Wittwer et al., 2001)

increased body size | somatic clone

(Oldham et al., 2002)

increased body weight | adult stage (with Pten^2L100)

(Ganguly et al., 2021)

increased cell death | somatic clone

(Nowak et al., 2013)

increased cell death | somatic clone | nutrition conditional

(Nowak et al., 2013)

increased cell growth rate

(Nowak et al., 2013)

increased cell growth rate | nutrition conditional

(Nowak et al., 2013)

increased cell number (with Pten^2L100)

(Oldham et al., 2002)

increased cell number | recessive | somatic clone

(Wittwer et al., 2001)

increased cell size (with Pten^2L100)

(Oldham et al., 2002)

increased cell size | adult stage | somatic clone

(Luo et al., 2020)

increased cell size | recessive | somatic clone

(Wittwer et al., 2001)

increased cell size | somatic clone

(Radimerski et al., 2002)

increased cell size | somatic clone | third instar larval stage

(Devilliers et al., 2021)

lethal - all die before end of larval stage | nutrition conditional (with Pten^2L100)

(Nowak et al., 2013)

majority die during larval stage

(Devilliers et al., 2021)

neoplasia | adult stage | somatic clone, with Scer\GAL4^repo.PU

(Read et al., 2009)

visible | recessive | somatic clone

(Wittwer et al., 2001)

visible | somatic clone

(Junger et al., 2003)

Phenotype Manifest In

adult head

(Oldham et al., 2000)

adult head | somatic clone

(Wittwer et al., 2001)

adult head capsule | somatic clone

(Junger et al., 2003)

adult optic lobe | adult stage | somatic clone

(Read et al., 2009)

dendrite | adult stage | somatic clone

(Luo et al., 2020)

distal medullary amacrine neuron Dm8 | adult stage | somatic clone

(Luo et al., 2020)

eye | somatic clone

(Nowak et al., 2013, Radimerski et al., 2002, Wittwer et al., 2001)

eye | somatic clone | nutrition conditional

(Nowak et al., 2013)

eye disc | somatic clone

(Nowak et al., 2013)

eye disc | somatic clone | nutrition conditional

(Nowak et al., 2013)

fat body | nutrition conditional

(Nowak et al., 2013)

glial cell | adult stage | somatic clone | increased number

(Read et al., 2009)

glial cell | somatic clone

(Read et al., 2009)

imaginal disc | nutrition conditional (with Pten^2L100)

(Nowak et al., 2013)

imaginal disc | somatic clone

(Nowak et al., 2013)

imaginal disc | somatic clone | nutrition conditional

(Nowak et al., 2013)

larval fat cell | somatic clone | third instar larval stage

(Devilliers et al., 2021)

ommatidium | somatic clone

(Nowak et al., 2013, Radimerski et al., 2002, Wittwer et al., 2001)

ommatidium | somatic clone | nutrition conditional

(Nowak et al., 2013)

wing

(Bardet et al., 2013)

wing | nutrition conditional

(Nowak et al., 2013)

Detailed Description

Statement

Reference

Pten¹¹⁷/Pten¹¹⁷ fat body clones, induced during embryogenesis and analyzed at the early third instar larval stage, bear larger cells than controls.

(Devilliers et al., 2021)

Pten¹¹⁷ mutant adult wings are slightly more elongated along the proximal-distal axis the wild-type ones.

(Bardet et al., 2013)

Pten¹¹⁷/Pten^2L100 mutant larvae and adult flies are larger than wild-type controls under normal food conditions. The prospective adult tissues, the eye and wing imaginal discs are larger than in controls. These larvae are highly sensitive to a reduction in yeast content, and although still larger, they do not survive to pupariation when reared on 10g/l yeast food. Pten¹¹⁷/Pten^2L100 mutant larvae reared on 100g/l yeast food at 39% larger than controls reared on 100g\l yeast food.

Pten¹¹⁷ imaginal disc clones are enlarged in larvae fed with yeasted food but do not severely impact on the structure of the imaginal discs and of the adult eyes. Under mild starvation conditions (30g/l yeast), Pten¹¹⁷ mutant clones are further increased in size, resulting in an overall increase in disc size as compared to discs harboring control clones. Reducing the yeast concentration to 20g/l and below leads to a massive size increase in the Pten¹¹⁷ clones and to a concomitant reduction of the surrounding tissue. Furthermore, the Pten¹¹⁷ clones fuse and render the discs a lobed appearance. At 5g/l yeast concentration, the eye discs with Pten¹¹⁷ mutant tissue are severely overgrown with polyp-like structures protruding from the discs. The resulting adult eyes display strong malformations and outgrowths, indicating a loss of epithelial integrity. In some cases, no clones can be recovered in the adult eyes, probably due to a collapse of the Pten¹¹⁷ clones resulting in melanized scars. Tangential eye sections do not reveal any structural defects in ommatidial arrangement. Pten¹¹⁷ mutant cells overgrow in a cell-autonomous manner as the enlarged ommatidia are exclusively composed of mutant cells. The overgrowth phenotype of Pten¹¹⁷ clones is not specific to the eye; it is observed in other imaginal tissues like the wing disc. As the Pten¹¹⁷ clones are overgrown after only 36hrs post induction, developmental delay is not the cause of the overgrowth.

Pten¹¹⁷ mutant eye clones exhibit overgrowth. The entire eye is enlarged in flies raised on normal food. Under starvation conditions, the mutant tissue occupies most of the adult eye and the wild-type tissue is severely reduced. This over-representation of the mutant tissue results in an absolute increase of eye size under starvation as compared to normal food conditions. In eyes almost entirely composed of Pten¹¹⁷ mutant tissue, the eye size increase is mainly caused by larger ommatidia (+27%), and to a minor extent by more ommatidia (+14%). Under starvation conditions (10g/l yeast), the ommatidial size is roughly proportionally reduced in wild-type and Pten¹¹⁷ mutant eyes. While the ommatidia number is decreased by 6% in wild-type eyes, it is massively decreased in Pten¹¹⁷ mutant eyes (+44%). Since the composition of the Pten¹¹⁷ mutant ommatidia remains unchanged, the size and number of ommatidia reflects cell size and cell number, indicating a switch from hypertrophy to hyperplasia.

Whereas only a few apoptotic cells are detected in heterozygous Pten¹¹⁷ cells under both fed and starving conditions, increased levels of apoptosis are observed within overgrowing Pten¹¹⁷ clones.

When transferred from starvation (10g/l yeast) to normal food (100g/l yeast) within the first 72 hours, Pten¹¹⁷ imaginal disc clones, the overgrowth of the mutant clones is efficiently rescued. Later shifts are no longer effective in suppressing the overgrowth. It is sufficient to transfer larvae within the first 48 hours from normal to starvation food to produce the overgrowth phenotype. After this time point, Pten¹¹⁷ imaginal disc clones do not acquire the full growth advantage over the surrounding tissue.

Under severe starvation (5g/l yeast content), the Pten¹¹⁷ mutant polyp-like structures outgrowing from the eye discs exhibit very high levels of apoptosis. Scars are visible, in the corresponding adult eyes, left behind by the collapsing clones. These eyes contain more wild-type cells, indicating that the lost Pten¹¹⁷ mutant tissue is compensated for.

A decrease in shoulder area (as a measure for body size) is observed under starvation but not under control conditions in fly heads mostly composed of Pten¹¹⁷ mutant clones. Consistently, the wing size and the fat body nuclear size are reduced, especially in animals raised under starvation conditions. Thus, the growth-reducing non-autonomous effect of Pten mutant tissue acts systemically.

(Nowak et al., 2013)

Pten¹¹⁷ mutant glial clones do not overgrow, but do show aberrant cytoplasmic projections.

Pten¹¹⁷ mutant optic lobe clones in adult flies contain a modest number of excess and abnormal glia relative to wild type controls.

(Read et al., 2009)

Head capsule enlarged - bighead phenotype.

(Junger et al., 2003)

Pten^2L100/Pten¹¹⁷ larvae, pupae and adults are substantially increased in size compared to control larvae. Mosaic flies in which the head is composed of homozygous Pten¹¹⁷ cells (clones generated using the "eyFLP" system) have disproportionally large heads. Pten^2L100/Pten¹¹⁷ adults are hypersensitive to starvation conditions compared to wild type.

(Oldham et al., 2002)

Somatic clones of Pten¹¹⁷ in the developing eye cause strong overgrowth of the eye. The size of ommatidia in clones is increased relative to wild-type.

(Radimerski et al., 2002)

Generation of flies in which the eye imaginal disc is homozygous for Pten¹¹⁷ (using the "ey-Flp" system) results in an increase in eye and head size compared to wild type. The increase in eye size is due to an increase in cell number and cell size as indicated by an increase in number and size of ommatidia.

(Wittwer et al., 2001)

Loss of Pten function in the eye and head capsule results in a fly with a big head.

(Oldham et al., 2000)

External Data

Linkouts

Interactions

Show genetic interaction network for Enhancers & Suppressors

Phenotypic Class

Enhanced by

Statement

Reference

Pten¹¹⁷ has increased cell size | third instar larval stage phenotype, enhanceable by Rheb^{EP50.084-loxP}/Scer\GAL4^Tub.PU

(Devilliers et al., 2021)

Pten¹¹⁷ has abnormal neuroanatomy | adult stage | somatic clone phenotype, enhanceable by sev⁴/sev⁴

(Luo et al., 2020)

Pten¹¹⁷ has increased cell death | somatic clone phenotype, enhanceable by slif^UY681/Scer\GAL4^Act5C.PP

(Nowak et al., 2013)

Pten¹¹⁷ has increased cell growth rate phenotype, enhanceable by ImpL2^UAS.cHa/Scer\GAL4^Act5C.PP

(Nowak et al., 2013)

Pten¹¹⁷ has increased body size phenotype, enhanceable by ImpL2^UAS.cHa/Scer\GAL4^Act5C.PP

(Nowak et al., 2013)

Pten¹¹⁷ has increased cell growth rate | somatic clone phenotype, enhanceable by ImpL2^UAS.cHa/Scer\GAL4^Act5C.PP

(Nowak et al., 2013)

Pten¹¹⁷, mTor^2L19 has increased cell growth rate | somatic clone phenotype, enhanceable by ImpL2^UAS.cHa/Scer\GAL4^Act5C.PP

(Nowak et al., 2013)

Pten¹¹⁷, Scer\GAL4^repo.PU has abnormal neuroanatomy | adult stage | somatic clone phenotype, enhanceable by Ras85D^V12.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Pten¹¹⁷, Scer\GAL4^repo.PU has neoplasia | adult stage | somatic clone phenotype, enhanceable by Ras85D^V12.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Pten¹¹⁷, Scer\GAL4^repo.PU has abnormal neuroanatomy | adult stage | somatic clone phenotype, enhanceable by Egfr^2.A887T.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Pten¹¹⁷, Scer\GAL4^repo.PU has neoplasia | adult stage | somatic clone phenotype, enhanceable by Egfr^2.A887T.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Pten¹¹⁷, Scer\GAL4^repo.PU has abnormal neuroanatomy | adult stage | somatic clone phenotype, enhanceable by btl::Egfr^λ.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Pten¹¹⁷, Scer\GAL4^repo.PU has neoplasia | adult stage | somatic clone phenotype, enhanceable by btl::Egfr^λ.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

NOT Enhanced by

Statement

Reference

Pten¹¹⁷ has abnormal neuroanatomy | adult stage | somatic clone phenotype, non-enhanceable by babo^DN.UAS.cUa/Scer\GAL4^{DIP-γ-MI03222-GAL4}

(Luo et al., 2020)

Pten¹¹⁷, Scer\GAL4^Act5C.PP, slif^UY681 has increased cell death | somatic clone phenotype, non-enhanceable by Atg5^RNAi.UAS, Scer\GAL4^Act5C.PP

(Nowak et al., 2013)

Pten¹¹⁷, Scer\GAL4^Act5C.PP, slif^UY681 has increased cell growth rate | somatic clone phenotype, non-enhanceable by Atg5^RNAi.UAS, Scer\GAL4^Act5C.PP

(Nowak et al., 2013)

Suppressed by

Statement

Reference

Pten¹¹⁷ has increased cell size | third instar larval stage phenotype, suppressible | partially by Scer\GAL4^da.PU/Pfk^GD1508

(Devilliers et al., 2021)

Pten¹¹⁷ has increased cell size | third instar larval stage phenotype, suppressible | partially by Scer\GAL4^da.PU/Pyk^GD16178

(Devilliers et al., 2021)

Pten¹¹⁷ has increased cell size | third instar larval stage phenotype, suppressible | partially by Scer\GAL4^da.PU/Pdha1^GD12103

(Devilliers et al., 2021)

Pten¹¹⁷ has increased cell size | third instar larval stage phenotype, suppressible | partially by Scer\GAL4^da.PU/Ldh^GD6887

(Devilliers et al., 2021)

Pten¹¹⁷ has increased cell size | third instar larval stage phenotype, suppressible | partially by Df(2L)FASN^Δ24-23/Df(2L)FASN^Δ24-23

(Devilliers et al., 2021)

Pten¹¹⁷, Rheb^{EP50.084-loxP}, Scer\GAL4^Tub.PU has increased cell size | third instar larval stage phenotype, suppressible | partially by Df(2L)FASN^Δ24-23/Df(2L)FASN^Δ24-23

(Devilliers et al., 2021)

Pten^2L100/Pten¹¹⁷ has increased body size | pupal stage phenotype, suppressible by Scer\GAL4^da.PU/Hsap\PTEN^UAS.cPa

(Ganguly et al., 2021)

Pten^2L100/Pten¹¹⁷ has increased body weight | adult stage phenotype, suppressible by Scer\GAL4^da.PU/Hsap\PTEN^UAS.cPa

(Ganguly et al., 2021)

Pten¹¹⁷ has abnormal neuroanatomy | somatic clone | adult stage phenotype, suppressible | partially by babo^Q302D.UAS/Scer\GAL4^{DIP-γ-MI03222-GAL4}

(Luo et al., 2020)

Pten¹¹⁷ has increased cell death | somatic clone phenotype, suppressible by bsk^DN.UAS/Scer\GAL4^Act5C.PP

(Nowak et al., 2013)

Pten¹¹⁷ has increased cell death | somatic clone | nutrition conditional phenotype, suppressible by bsk^DN.UAS/Scer\GAL4^Act5C.PP

(Nowak et al., 2013)

Pten¹¹⁷ has increased cell growth rate | somatic clone | nutrition conditional phenotype, suppressible by bsk^DN.UAS/Scer\GAL4^Act5C.PP

(Nowak et al., 2013)

Pten¹¹⁷ has increased cell growth rate | somatic clone phenotype, suppressible by InR⁰⁵⁵⁴⁵

(Nowak et al., 2013)

Pten¹¹⁷ has increased cell growth rate | nutrition conditional phenotype, suppressible by Akt¹

(Nowak et al., 2013)

Pten¹¹⁷ has increased cell growth rate phenotype, suppressible by Akt¹

(Nowak et al., 2013)

Pten¹¹⁷ has increased cell growth rate | nutrition conditional phenotype, suppressible by Akt³

(Nowak et al., 2013)

Pten¹¹⁷ has increased cell growth rate phenotype, suppressible by Akt³

(Nowak et al., 2013)

Pten¹¹⁷ has increased cell growth rate | nutrition conditional phenotype, suppressible by gig^UAS.cTa/Tsc1^UAS.cTa/Scer\GAL4^GMR.PU

(Nowak et al., 2013)

Pten¹¹⁷ has increased cell growth rate phenotype, suppressible by gig^UAS.cTa/Tsc1^UAS.cTa/Scer\GAL4^GMR.PU

(Nowak et al., 2013)

Pten¹¹⁷ has increased cell growth rate phenotype, suppressible by mTor^2L19

(Nowak et al., 2013)

Pten¹¹⁷ has increased cell growth rate | somatic clone | nutrition conditional phenotype, suppressible by Ilp2^UAS.cBa/Scer\GAL4^ey.PU

(Nowak et al., 2013)

Pten¹¹⁷ has increased cell growth rate | somatic clone | nutrition conditional phenotype, suppressible by Tsc1^Q87X

(Nowak et al., 2013)

Pten¹¹⁷ has visible | somatic clone phenotype, suppressible by foxo²⁵

(Junger et al., 2003)

Pten¹¹⁷ has increased body size | recessive | somatic clone phenotype, suppressible by lilli^4U5

(Wittwer et al., 2001)

NOT suppressed by

Statement

Reference

Pten¹¹⁷ has abnormal neuroanatomy | somatic clone | adult stage phenotype, non-suppressible by babo^DN.UAS.cUa/Scer\GAL4^{DIP-γ-MI03222-GAL4}

(Luo et al., 2020)

Pten¹¹⁷ has increased cell size | somatic clone phenotype, non-suppressible by S6k^l-1/S6k^l-1

(Radimerski et al., 2002)

Enhancer of

Statement

Reference

Pten¹¹⁷/Pten¹¹⁷ is an enhancer of increased cell size | third instar larval stage phenotype of Rheb^{EP50.084-loxP}, Scer\GAL4^Tub.PU

(Devilliers et al., 2021)

Pten¹¹⁷ is an enhancer of abnormal neuroanatomy | third instar larval stage phenotype of Scer\GAL4^repo.PU, btl::Egfr^λ.UAS

(Read et al., 2009)

Pten¹¹⁷ is an enhancer of abnormal neuroanatomy | adult stage | somatic clone phenotype of Egfr^2.A887T.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Pten¹¹⁷ is an enhancer of neoplasia | adult stage | somatic clone phenotype of Egfr^2.A887T.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Pten¹¹⁷ is an enhancer of neoplasia | third instar larval stage phenotype of Scer\GAL4^repo.PU, btl::Egfr^λ.UAS

(Read et al., 2009)

Pten¹¹⁷ is an enhancer of neoplasia | adult stage | somatic clone phenotype of Ras85D^V12.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Suppressor of

Statement

Reference

Pten¹¹⁷/Pten¹¹⁷ is a suppressor of decreased cell size | third instar larval stage | somatic clone - Minute background phenotype of mTor^2L1

(Devilliers et al., 2021)

Pten¹¹⁷/Pten[+] is a suppressor | partially of abnormal size | adult stage phenotype of Ide^UAS.cGa, Scer\GAL4^Bx-MS1096-KE

(Galagovsky et al., 2014)

Pten¹¹⁷/Pten[+] is a suppressor | partially of abnormal size | adult stage phenotype of Ide^UAS.cGa, Scer\GAL4^en-e16E

(Galagovsky et al., 2014)

Pten¹¹⁷/Pten[+] is a suppressor of abnormal size phenotype of Ide^GD6073, Scer\GAL4^en-e16E

(Galagovsky et al., 2014)

Pten^2L100/Pten¹¹⁷ is a suppressor | partially of lethal | larval stage phenotype of InR^93Dj-4/InR³⁰⁴

(Oldham et al., 2002)

Pten^2L100/Pten¹¹⁷ is a suppressor | partially of lethal | larval stage phenotype of InR³²⁷/InR³⁰⁴

(Oldham et al., 2002)

Pten¹¹⁷/Pten¹¹⁷ is a suppressor of decreased body size | somatic clone phenotype of Pi3K21B^unspecified

(Oldham et al., 2002)

Pten¹¹⁷ is a suppressor of decreased body size | recessive | somatic clone phenotype of lilli^4U5

(Wittwer et al., 2001)

NOT Suppressor of

Statement

Reference

Pten¹¹⁷/Pten¹¹⁷ is a non-suppressor of decreased cell size | third instar larval stage | somatic clone - Minute background phenotype of mTor^ΔP

(Devilliers et al., 2021)

Pten¹¹⁷/Pten¹¹⁷ is a non-suppressor of decreased cell size | third instar larval stage | somatic clone - Minute background phenotype of mTor^2L19

(Devilliers et al., 2021)

Pten^2L100/Pten¹¹⁷ is a non-suppressor of lethal phenotype of Pi3K92E^unspecified

(Oldham et al., 2002)

Pten¹¹⁷/Pten¹¹⁷ is a non-suppressor of decreased body size | somatic clone phenotype of Pi3K92E^unspecified

(Oldham et al., 2002)

Other

Statement

Reference

Pten¹¹⁷, mTor^2L1 has decreased cell number | third instar larval stage | somatic clone - Minute background phenotype

(Devilliers et al., 2021)

Akt¹/Akt³, Pten¹¹⁷ has viable phenotype

(Lee et al., 2003)

Pi3K21B^unspecified, Pten^2L100/Pten¹¹⁷ has viable phenotype

(Oldham et al., 2002)

InR³²⁷/InR³⁰⁴, Pten^2L100/Pten¹¹⁷ has lethal | pupal stage phenotype

(Oldham et al., 2002)

InR^93Dj-4/InR³⁰⁴, Pten^2L100/Pten¹¹⁷ has lethal | pupal stage phenotype

(Oldham et al., 2002)

Phenotype Manifest In

Enhanced by

Statement

Reference

Pten¹¹⁷ has larval fat cell | third instar larval stage | somatic clone phenotype, enhanceable by Rheb^{EP50.084-loxP}/Scer\GAL4^Tub.PU

(Devilliers et al., 2021)

Pten¹¹⁷ has distal medullary amacrine neuron Dm8 | adult stage | somatic clone phenotype, enhanceable by sev⁴/sev⁴

(Luo et al., 2020)

Pten¹¹⁷ has dendrite | adult stage | somatic clone phenotype, enhanceable by sev⁴/sev⁴

(Luo et al., 2020)

Pten¹¹⁷, Scer\GAL4^repo.PU has adult optic lobe | adult stage | somatic clone phenotype, enhanceable by Ras85D^V12.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Pten¹¹⁷, Scer\GAL4^repo.PU has glial cell | adult stage | increased number | somatic clone phenotype, enhanceable by Egfr^2.A887T.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Pten¹¹⁷, Scer\GAL4^repo.PU has adult brain | somatic clone phenotype, enhanceable by Egfr^2.A887T.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Pten¹¹⁷, Scer\GAL4^repo.PU has adult optic lobe | adult stage | somatic clone phenotype, enhanceable by Egfr^2.A887T.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Pten¹¹⁷, Scer\GAL4^repo.PU has glial cell | adult stage | increased number | somatic clone phenotype, enhanceable by btl::Egfr^λ.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Pten¹¹⁷, Scer\GAL4^repo.PU has adult brain | somatic clone phenotype, enhanceable by btl::Egfr^λ.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Pten¹¹⁷, Scer\GAL4^repo.PU has adult optic lobe | adult stage | somatic clone phenotype, enhanceable by btl::Egfr^λ.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Pten¹¹⁷, Scer\GAL4^repo.PU has glial cell | adult stage | increased number | somatic clone phenotype, enhanceable by Ras85D^V12.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Pten¹¹⁷, Scer\GAL4^repo.PU has adult brain | somatic clone phenotype, enhanceable by Ras85D^V12.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

NOT Enhanced by

Statement

Reference

Pten¹¹⁷ has distal medullary amacrine neuron Dm8 | adult stage | somatic clone phenotype, non-enhanceable by babo^DN.UAS.cUa/Scer\GAL4^{DIP-γ-MI03222-GAL4}

(Luo et al., 2020)

Pten¹¹⁷ has dendrite | adult stage | somatic clone phenotype, non-enhanceable by babo^DN.UAS.cUa/Scer\GAL4^{DIP-γ-MI03222-GAL4}

(Luo et al., 2020)

Suppressed by

Statement

Reference

Pten¹¹⁷ has larval fat cell | somatic clone | third instar larval stage phenotype, suppressible | partially by Scer\GAL4^da.PU/FASN1^GD14739

(Devilliers et al., 2021)

Pten¹¹⁷ has larval fat cell | somatic clone | third instar larval stage phenotype, suppressible | partially by Scer\GAL4^da.PU/Pdha1^GD12103

(Devilliers et al., 2021)

Pten¹¹⁷ has larval fat cell | somatic clone | third instar larval stage phenotype, suppressible | partially by Scer\GAL4^da.PU/Ldh^GD6887

(Devilliers et al., 2021)

Pten¹¹⁷ has larval fat cell | somatic clone | third instar larval stage phenotype, suppressible | partially by Scer\GAL4^da.PU/Pyk^GD16178

(Devilliers et al., 2021)

Pten¹¹⁷ has larval fat cell | somatic clone | third instar larval stage phenotype, suppressible | partially by Scer\GAL4^da.PU/Pfk^GD1508

(Devilliers et al., 2021)

Pten¹¹⁷ has larval fat cell | somatic clone | third instar larval stage phenotype, suppressible | partially by Df(2L)FASN^Δ24-23/Df(2L)FASN^Δ24-23

(Devilliers et al., 2021)

Pten¹¹⁷, Rheb^{EP50.084-loxP}, Scer\GAL4^Tub.PU has larval fat cell | somatic clone | third instar larval stage phenotype, suppressible | partially by Df(2L)FASN^Δ24-23/Df(2L)FASN^Δ24-23

(Devilliers et al., 2021)

Pten¹¹⁷ has distal medullary amacrine neuron Dm8 | somatic clone | adult stage phenotype, suppressible | partially by babo^Q302D.UAS/Scer\GAL4^{DIP-γ-MI03222-GAL4}

(Luo et al., 2020)

Pten¹¹⁷ has dendrite | somatic clone | adult stage phenotype, suppressible | partially by babo^Q302D.UAS/Scer\GAL4^{DIP-γ-MI03222-GAL4}

(Luo et al., 2020)

Pten¹¹⁷ has eye | somatic clone phenotype, suppressible by bsk^DN.UAS/Scer\GAL4^Act5C.PP

(Nowak et al., 2013)

Pten¹¹⁷ has eye | somatic clone | nutrition conditional phenotype, suppressible by bsk^DN.UAS/Scer\GAL4^Act5C.PP

(Nowak et al., 2013)

Pten¹¹⁷ has eye | somatic clone phenotype, suppressible by InR⁰⁵⁵⁴⁵

(Nowak et al., 2013)

Pten¹¹⁷ has eye | nutrition conditional phenotype, suppressible by Akt¹

(Nowak et al., 2013)

Pten¹¹⁷ has eye phenotype, suppressible by Akt¹

(Nowak et al., 2013)

Pten¹¹⁷ has eye | nutrition conditional phenotype, suppressible by Akt³

(Nowak et al., 2013)

Pten¹¹⁷ has eye phenotype, suppressible by Akt³

(Nowak et al., 2013)

Pten¹¹⁷ has eye phenotype, suppressible by gig^UAS.cTa/Tsc1^UAS.cTa/Scer\GAL4^GMR.PU

(Nowak et al., 2013)

Pten¹¹⁷ has eye phenotype, suppressible by mTor^2L19

(Nowak et al., 2013)

Pten¹¹⁷ has eye | somatic clone phenotype, suppressible by slif^UY681/Scer\GAL4^Act5C.PP

(Nowak et al., 2013)

Pten¹¹⁷ has eye | somatic clone | nutrition conditional phenotype, suppressible by Ilp2^UAS.cBa/Scer\GAL4^ey.PU

(Nowak et al., 2013)

Pten^dj189/Pten¹¹⁷ has eye phenotype, suppressible by Akt¹/Akt³

(Pinal et al., 2006)

Pten^dj189/Pten¹¹⁷ has rhabdomere phenotype, suppressible by Akt¹/Akt³

(Pinal et al., 2006)

Pten¹¹⁷ has adult head capsule | somatic clone phenotype, suppressible by foxo²⁵

(Junger et al., 2003)

Pten¹¹⁷ has adult head phenotype, suppressible by mTor^EP2353

(Oldham et al., 2000)

NOT suppressed by

Statement

Reference

Pten¹¹⁷ has distal medullary amacrine neuron Dm8 | somatic clone | adult stage phenotype, non-suppressible by babo^DN.UAS.cUa/Scer\GAL4^{DIP-γ-MI03222-GAL4}

(Luo et al., 2020)

Pten¹¹⁷ has dendrite | somatic clone | adult stage phenotype, non-suppressible by babo^DN.UAS.cUa/Scer\GAL4^{DIP-γ-MI03222-GAL4}

(Luo et al., 2020)

Pten¹¹⁷ has eye | somatic clone phenotype, non-suppressible by S6k^l-1/S6k^l-1

(Radimerski et al., 2002)

Pten¹¹⁷ has ommatidium | somatic clone phenotype, non-suppressible by S6k^l-1/S6k^l-1

(Radimerski et al., 2002)

Enhancer of

Statement

Reference

Pten¹¹⁷/Pten¹¹⁷ is an enhancer of larval fat cell | third instar larval stage | somatic clone phenotype of Rheb^{EP50.084-loxP}, Scer\GAL4^Tub.PU

(Devilliers et al., 2021)

Pten¹¹⁷ is an enhancer of glial cell | adult stage | increased number | somatic clone phenotype of Scer\GAL4^repo.PU, btl::Egfr^λ.UAS

(Read et al., 2009)

Pten¹¹⁷ is an enhancer of adult brain | somatic clone phenotype of Scer\GAL4^repo.PU, btl::Egfr^λ.UAS

(Read et al., 2009)

Pten¹¹⁷ is an enhancer of glial cell | adult stage | increased number | somatic clone phenotype of Egfr^2.A887T.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Pten¹¹⁷ is an enhancer of adult brain | somatic clone phenotype of Egfr^2.A887T.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Pten¹¹⁷ is an enhancer of adult optic lobe | adult stage | somatic clone phenotype of Egfr^2.A887T.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Pten¹¹⁷ is an enhancer of glial cell | adult stage | increased number | somatic clone phenotype of Ras85D^V12.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Pten¹¹⁷ is an enhancer of adult brain | somatic clone phenotype of Ras85D^V12.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Pten¹¹⁷ is an enhancer of adult optic lobe | adult stage | somatic clone phenotype of Ras85D^V12.UAS, Scer\GAL4^repo.PU

(Read et al., 2009)

Suppressor of

Statement

Reference

Pten¹¹⁷/Pten¹¹⁷ is a suppressor of larval fat cell | third instar larval stage | somatic clone - Minute background phenotype of mTor^2L1

(Devilliers et al., 2021)

Pten¹¹⁷/Pten[+] is a suppressor | partially of wing phenotype of Ide^UAS.cGa, Scer\GAL4^Bx-MS1096-KE

(Galagovsky et al., 2014)

Pten¹¹⁷/Pten[+] is a suppressor | partially of wing phenotype of Ide^UAS.cGa, Scer\GAL4^en-e16E

(Galagovsky et al., 2014)

Pten¹¹⁷/Pten[+] is a suppressor of wing blade posterior compartment phenotype of Ide^GD6073, Scer\GAL4^en-e16E

(Galagovsky et al., 2014)

Pten¹¹⁷/Pten¹¹⁷ is a suppressor of eye | somatic clone phenotype of Rheb^2D1

(Stocker et al., 2003)

Pten¹¹⁷/Pten¹¹⁷ is a suppressor of ommatidium | somatic clone phenotype of Rheb^2D1

(Stocker et al., 2003)

NOT Suppressor of

Statement

Reference

Pten¹¹⁷/Pten¹¹⁷ is a non-suppressor of larval fat cell | third instar larval stage | somatic clone - Minute background phenotype of mTor^ΔP

(Devilliers et al., 2021)

Pten¹¹⁷/Pten¹¹⁷ is a non-suppressor of larval fat cell | third instar larval stage | somatic clone - Minute background phenotype of mTor^2L19

(Devilliers et al., 2021)

Other

Statement

Reference

Pten¹¹⁷, mTor^2L1 has larval fat cell | third instar larval stage | somatic clone - Minute background phenotype

(Devilliers et al., 2021)

Akt¹/Akt³, Pten^dj189/Pten¹¹⁷ has lipid particle & nurse cell phenotype

(Vereshchagina and Wilson, 2006)

Additional Comments

Genetic Interactions

Statement

Reference

The small cell size in Tor^2L1/Tor^2L1 third instar larval fat body clones (in a Minute background) is suppressed by clonal Pten¹¹⁷, even leading to larger cells than in controls.

(Devilliers et al., 2021)

Expression of bsk^DN.Scer\UAS in Pten¹¹⁷ eye clones (using the MARCM system) efficiently blocks apoptosis and enhanced the overgrowth phenotype.

A InR⁰⁵⁵⁴⁵ mutant background only slightly reduces the overgrowth found in Pten¹¹⁷ mutant eye clones.

An Akt1¹ or Akt1³ mutant background completely suppresses the Pten¹¹⁷ overgrowth phenotype, under normal as well as under starvation conditions.

Reduction of TORC1 through expression of Tsc1^Scer\UAS.cTa and gig^Scer\UAS.cTa (under the control of Scer\GAL4^GMR.PU) suppresses the overgrowth of Pten¹¹⁷ mutant tissue.

Eyes mutant for Pten¹¹⁷ and Tor^2L19 are reduced to the size of control eyes at both fed and starved conditions, indicating that the overgrowth of Pten¹¹⁷ clones depends on normal TORC1 function.

Expression of slif^UY681 in Pten¹¹⁷ mutant clones results in a slight reduction of the mutant tissue under normal conditions. Under starvation conditions (10g/l yeast), these double mutant cells are almost completely eliminated. This loss of Pten¹¹⁷ mutant tissue is accompanied by a massive increase in apoptosis. The structure of adult eyes in these mutants are wild-type, indicating that the surrounding tissue is able to compensate for the loss of the clones.

Knockdown of Atg5, through expression of Atg5^{dsRNA.Scer\UAS}, does not impact on the initial growth of Pten¹¹⁷ clones with reduced slif function (through expression of slif^UY681).

Expression of Ilp2^Scer\UAS.cBa under the control of Scer\GAL4^ey.PU suppresses the overgrowth found in Pten¹¹⁷ mutant clones under starvation conditions. Furthermore, expression of Ilp2^Scer\UAS.cBa restores the growth of both the tissue surrounding the Pten¹¹⁷ clone and peripheral tissue.

The introduction of Tsc1^Q87X clones into the neighborhood of Pten¹¹⁷ clones reduces the overgrowth phenotype, under starvation conditions. Thus, even when neighboring with a tissue that also has a growth advantage, Pten clones themselves experience competition for common resources.

The generation of Pten¹¹⁷ and Tor^2L19 sister clones results in eyes that are completely composed of Pten mutant tissue. However, these eyes are smaller than those without Tor^2L19 mutant sister clones.

Ubiquitous expression of ImpL2^Scer\UAS.cHa (under the control of Scer\GAL4^Act5C.PP) results in the overgrowth of Pten¹¹⁷ clones, irrespective of whether they neighbor Tor^2L19 mutant or wild-type cells. The overgrowth of Pten¹¹⁷ clones causes a further reduction in body size, as evidenced by decreased shoulder width.

(Nowak et al., 2013)

Ras85D^V12.Scer\UAS Pten¹¹⁷ double mutant clones generated under the control of Scer\GAL4^repo.PU are overgrown and invasive. Cells from mutant clones appear to invade the brain, typically following fibre tracts, and sometimes inducing the formation of trachea. Mutant cells often penetrate deep into the brain. Smaller clones are commonly seen that are composed of relatively differentiated, enlarged glia with diffusely invasive projections.

Ras85D^V12.Scer\UAS Pten¹¹⁷ double mutant optic lobe clones generated using eyFLP under the control of Scer\GAL4^repo.PU contain more excess glial cells than in either mutant alone. The clones are composed of 10s of glial cells in third instar larvae, becoming large invasive tumors composed of hundreds to thousands of cells in adults.

Egfr^{2.A887T.Scer\UAS} Pten¹¹⁷ double mutant clones generated under the control of Scer\GAL4^repo.PU are overgrown and invasive. Cells from mutant clones appear to invade the brain, typically following fibre tracts, and sometimes inducing the formation of trachea. Mutant cells often penetrate deep into the brain. Smaller clones are commonly seen that are composed of relatively differentiated, enlarged glia with diffusely invasive projections.

Egfr^{2.A887T.Scer\UAS} Pten¹¹⁷ double mutant clones generated using eyFLP under the control of Scer\GAL4^repo.PU contain more excess glial cells than in either mutant alone. The clones are composed of 10s of glial cells in third instar larvae, becoming large invasive tumors composed of hundreds to thousands of cells in adults.

btl::Egfr^{Scer\UAS.T:λ\cI-DD} Pten¹¹⁷ double mutant clones generated under the control of Scer\GAL4^repo.PU are overgrown and invasive. Cells from mutant clones appear to invade the brain, typically following fibre tracts, and sometimes inducing the formation of trachea. Mutant cells often penetrate deep into the brain. Smaller clones are commonly seen that are composed of relatively differentiated, enlarged glia with diffusely invasive projections.

btl::Egfr^{Scer\UAS.T:λ\cI-DD} Pten¹¹⁷ double mutant clones generated using eyFLP under the control of Scer\GAL4^repo.PU contain more excess glial cells than in Pten¹¹⁷ alone. The clones are composed of 10s of glial cells in third instar larvae, becoming large invasive tumors composed of hundreds to thousands of cells in adults.

(Read et al., 2009)

The rhabdomere defects seen in Pten¹¹⁷/Pten^dj189 mutant fly eyes are rescued in a Akt1¹/Akt1³ mutant background. In these animals photoreceptor cell morphology is close to wild-type and eyes display a low frequency of deformed rhabdomeres.

(Pinal et al., 2006)

The nurse cells of Pten^dj189/Pten¹¹⁷; Akt1³/Akt1¹ viable females show normal lipid storage, while clones of Pten alleles show formation of large lipid droplets.

(Vereshchagina and Wilson, 2006)

Pten¹¹⁷ ; Akt1¹/Akt1³ photoreceptors have normal morphology and an electroretinogram similar to wild type using a normal PDA paradigm.

(Lee et al., 2003)

The small rough eye phenotype see in flies with Rheb^2D1 somatic clones throughout the eye disc generated using Scer\FLP1^ey.PN and Scer\FRT, is largely suppressed by Pten¹¹⁷/Pten¹¹⁷.

(Stocker et al., 2003)

Mosaic flies in which the head is doubly mutant for InR³²⁷ and Pten¹¹⁷ have heads which are almost the size of heads singly mutant for Pten¹¹⁷.

(Oldham et al., 2002)

Eye overgrowth caused by somatic clones of Pten¹¹⁷ in the developing eye and the increase in ommatidia size within the clones are not suppressed in homozygous S6k^l-1 animals.

(Radimerski et al., 2002)

Heads that are doubly mutant for Pten¹¹⁷ and lilli^4U5 are smaller than those of Pten¹¹⁷ single mutants and wild-type flies.

(Wittwer et al., 2001)

The head defect seen in Pten¹¹⁷ flies is suppressed by Tor^EP2353.

(Oldham et al., 2000)

Xenogenetic Interactions

Statement

Reference

Expression of BacA\p35^Scer\UAS.cHa in Pten¹¹⁷ eye clones (using the MARCM system) efficiently blocks apoptosis and enhanced the overgrowth phenotype.

Expression of BacA\p35^Scer\UAS.cHa in the dorsal half of the eye under the control of Scer\GAL4^mirr-DE blocks apoptosis, results in Pten¹¹⁷ clones overgrowing even more in the dorsal compartment.

Blocking apoptosis, through expression of BacA\p35^Scer\UAS.cHa in Pten¹¹⁷ clones with diminished slif function (through expression of slif^UY681), delays the collapse of the clones but they are absent from adult eyes.

(Nowak et al., 2013)

Complementation and Rescue Data

Comments

Images (0)

Mutant

Wild-type

Stocks (2)

Bloomington

80967

y¹ w^*; Pten¹¹⁷/CyO

80968

y¹ w^*; Pten¹¹⁷/CyO; P{hs-Pten}3C1

Notes on Origin

Discoverer

External Crossreferences and Linkouts ( 0 )

Synonyms and Secondary IDs (8)

Reported As

Symbol Synonym

PTEN^117.35

(Wittwer et al., 2001)

PTEN¹¹⁷

(Paglia et al., 2017, Nowak et al., 2013, Pinal et al., 2006)

PTEN^2L117

(Galagovsky et al., 2014, Read et al., 2009, Reiling and Hafen, 2004, Stocker et al., 2003)

Pten¹¹⁷

(Ganguly et al., 2021, Han et al., 2021, Parniewska and Stocker, 2020, Pfeifle et al., 2019, Pickering et al., 2013, Tokusumi et al., 2012, Zheng and Sehgal, 2010, Vereshchagina and Wilson, 2006)

Pten^2L117

(Luo et al., 2020, Rhiner et al., 2009, Oldham et al., 2002)

dPTEN^117-4

(Junger et al., 2003)

dPTEN¹¹⁷

(Lee et al., 2003, Radimerski et al., 2002, Stocker et al., 2002)

pten¹¹⁷

(Bardet et al., 2013)

Name Synonyms

Secondary FlyBase IDs

References (26)

Report Sections

Open Close