Open Close
General Information
Interaction Type
Interacting Genes
FlyBase ID
FBig0000102612
Interaction Network
Interactions Browser links
step network
esyN Network Diagram
Show neighbor-neighbor interactions:
Select Layout:
Legend:
Protein
RNA
Selected Interactor(s)
Common Interactor(s)
Reported Interactions
FBrf0227539-22.FW.WB
Reference
Description
physical association
Collection
Source/Stage
Cell line used
Participants
Corresponds to
Reported as
Role
Note
step 

Step

bait

MBP tag

step 

Step

prey

GST tag

step 
Experimental entities
Corresponds to
Identifier
Reported
Role
Note
Subregions with role in interaction
Corresponds to
Description
Role
Coordinates
Note
step 
coiled-coil domain
necessary binding region
EQQKLLIELRRKKQELLLEIQQIKDELCEVVSEMEALDVP

ΔCC of the 410-aa isoform

Isoform-specific participants
Corresponds to
Description
Role
Note
Comments concerning this interaction

Interaction in vitro; bait produced as a recombinant fusion protein in bacterial system; prey produced as a recombinant fusion protein in bacterial system.

MBP-tagged step was fractionated by SDS-PAGE, transferred to nitrocellulose, then overlaid with GST-tagged step. Binding of GST-step to MBP-step was assessed by anti-GST antibodies.

External Crossreferences and Linkouts ( 0 )
References (1)