Open Close
General Information
Interaction Type
Interacting Genes
FlyBase ID
FBig0000102973
Interaction Network
Interactions Browser links
Atf6 network
maf-S network
esyN Network Diagram
Show neighbor-neighbor interactions:
Select Layout:
Legend:
Protein
RNA
Selected Interactor(s)
Common Interactor(s)
Reported Interactions
FBrf0227576-6.FRET
Description
physical association
Collection
Source/Stage
Cell line used
Participants
Corresponds to
Reported as
Role
Note
Atf6 

DM15

fluorescence donor

fluorescein label

Atf6 

DM15

fluorescence donor

fluorescein label

Atf6 
Atf6 

DM15

fluorescence donor

fluorescein label

Atf6 

DM31

fluorescence acceptor

TAMRA label

DM31

fluorescence acceptor

TAMRA label

DM31

fluorescence acceptor

TAMRA label

Experimental entities
Corresponds to
Identifier
Reported
Role
Note
Subregions with role in interaction
Corresponds to
Description
Role
Coordinates
Note
Atf6 
bZIP domain
sufficient binding region
TPSHTMDDKIYKKYQRMIKNRESASLSRKKRKEYVVSLETRINKLEKECDSLKAENITLRDQIFLLA
bZIP domain
sufficient binding region
RGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKKSYEWTELEQMHEDNEQVRREVSNWKNKYKALLQFAIQNE
Isoform-specific participants
Corresponds to
Description
Role
Note
Comments concerning this interaction

Interaction in vitro; fluorescence donor produced as a recombinant fusion protein in bacterial system and labeled in vitro; fluorescence acceptor produced as a recombinant fusion protein in bacterial system and labeled in vitro.

Dissociation constant of Kd=1170nM.

Interactions between bZIP proteins were quantified in vitro using a solution FRET assay at 4oC, 21oC and 37oC. Only interactions at 21oC with Kd < 5000 nm were curated by FlyBase.

External Crossreferences and Linkouts ( 1 )
Linkouts
MIST - An integrated Molecular Interaction Database
References (1)