Open Close
General Information
Symbol
Dmel\CG3638-PB
Species
D. melanogaster
Annotation Symbol
CG3638-PB
FlyBase ID
FBpp0070239
Associated gene
Length (aa)
639
Theoretical pI
8.42
Predicted MW (kDa)
69.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MEQPSILVKILHSIPHVNYTFRRVNDTFNPDSDVYLESLVILASIPAGLLIGSLLGLLLYLLTRCCDRRQRKPSAQRCQS
CSLVIITLMTCAAIGLGLYGNDDFHNGLLQAFGSGKSVEGLVLTLKRQTESIKHDLETRMAGHKVEQLVEKPHYNQTVVM
LLIETSRLVTENTSRAVASLDSMVHYFMKAKGSENDTSLMGLLQLGEFYESIRWPATLAFLTVLLLLCTVLVIGVARRSR
CTLIFFSVSGLFCIIICWLLAGVYLASSVAAGDFCMRPHDYMCRQVGMRSPYVDFLNCGTPRNRFILRLNESRDLVDRAR
ESVEHMQRMSQETYPHIDIQRTLNAMDNDLEITLRNLTTLSATLDRRTIDMHYEEALRGLCGGGLLGLSLMMVAGLLTSF
LLTILVYADSHAWIYLTKRPTLDADKSETAPLFPASNAPSASISPTAPLSTGTINRTLLHHQQASSGGGSGTLPGSGGGA
GAGGGVGANGHNGVGPYRNGSAGLRQGLASPSSQSSHTSSTATYNNGTTSYHNSHQQHNNHLYSNHYSHSNNHYNNTQHR
TNPAAGAVAAAVGVVSSGQRSPSPPPVYDLVHGTRSGHHTLGRLPSHHQQSATYLPGPNNGKYATLSKQCKTLESNDFY
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0070249
8332
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0308707
6037
FBtr0330205
6097
FBtr0330206
6636
FBtr0330207
6755
FBtr0336978
8745
FBtr0346960
6636
FBtr0347011
6097
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0300913
639
FBpp0303238
1472
FBpp0303239
1136
FBpp0303240
586
FBpp0307920
655
FBpp0312424
551
FBpp0312444
1224
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG3638-PB
Name Synonyms
Secondary FlyBase IDs
    References (2)