Open Close
General Information
Symbol
Dmel\sgg-PD
Species
D. melanogaster
Annotation Symbol
CG2621-PD
FlyBase ID
FBpp0070454
Associated gene
Length (aa)
1067
Theoretical pI
5.58
Predicted MW (kDa)
114.4
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MATTTTTQAAGAAPALNLLPASNNNINNTLINNNNNNNNTSNSNNNNNNVISQPIKIPLTERFSSQTSTGSADSGVIVSS
ASQQQLQLPPPRSSSGSLSLPQAPPGGKWRQKQQRQQLLLSQDSGIENGVTTRPSKAKDNQGAGKASHNATSSKESGAQS
NSSSESLGSNCSEAQEQQRVRASSALELSSVDTPVIVGGVVSGGNSILRSRIKYKSTNSTGTQGFDVEDRIDEVDICDDD
DVDCDDRGSEIEEEEEEEEDDGVNVDDDVEEADNQSDNQSGIIINLKSQTEQEEEVDEVDAKPKNRLLPPDQAELTVAAA
MARRRDAKSLATDGHIYFPLLKISEDPHIDSKLINRKDGLQDTMYYLDEFGSPKLREKFARKQKQLLAKQQKQLMKRERR
SEEQRKKRNTTVASNLAASGAVVDDTKDDYKQQPHCDTSSRSKNNSVPNPPSSHLHQNHNHLVVDVQEDVDDVNVVATSD
VDSGVVKMRRHSHDNHYDRIPRSNAATITTRPQIDQQSSHHQNTEDVEQGAEPQIDGEADLDADADADSDGSGENVKTAK
LARTQSCVSWTKVVQKFKNILGRDGSKITTVVATPGQGTDRVQEVSYTDTKVIGNGSFGVVFQAKLCDTGELVAIKKVLQ
DRRFKNRELQIMRKLEHCNIVKLLYFFYSSGEKRDEVFLNLVLEYIPETVYKVARQYAKTKQTIPINFIRLYMYQLFRSL
AYIHSLGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLLHGEPNVSYICSRYYRAPELIFGAINYTTKIDVWSAGCVLAE
LLLGQPIFPGDSGVDQLVEVIKVLGTPTREQIREMNPNYTEFKFPQIKSHPWQKVFRIRTPTEAINLVSLLLEYTPSARI
TPLKACAHPFFDELRMEGNHTLPNGRDMPPLFNFTEHELSIQPSLVPQLLPKHLQNASGPGGNRPSAGGAASIAASGSTS
VSSTGSGASVEGSAQPQSQGTAAAAGSGSGGATAGTGGASAGGPGSGNNSSSGGASGAPSAVAAGGANAAVAGGAGGGGG
AGAATAAATATGAIGATNAGGANVTDS
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0070471
4805
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0070467
2929
FBtr0070466
2847
FBtr0070470
3110
FBtr0070468
3055
FBtr0070469
4244
FBtr0070475
3174
FBtr0070472
3021
FBtr0070473
3091
FBtr0070474
3218
FBtr0070476
2745
FBtr0112828
2903
FBtr0301966
3182
FBtr0302185
2166
FBtr0331751
4750
FBtr0331752
4499
FBtr0331753
5004
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0070450
575
FBpp0070449
514
FBpp0070453
514
FBpp0070451
514
FBpp0070452
514
FBpp0089160
496
FBpp0089162
514
FBpp0089158
514
FBpp0089159
575
FBpp0089161
416
FBpp0111741
772
FBpp0291178
416
FBpp0291395
441
FBpp0304139
1126
FBpp0304140
1168
FBpp0304141
597
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG2621-PD
Name Synonyms
Secondary FlyBase IDs
    References (1)