Open Close
General Information
Symbol
Dmel\CG3168-PB
Species
D. melanogaster
Annotation Symbol
CG3168-PB
FlyBase ID
FBpp0070946
Associated gene
Length (aa)
632
Theoretical pI
8.03
Predicted MW (kDa)
69.0
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MVEGDSAKGKSEFYNVEAGLQPNYNQSAASNQASNHPTGQANAPATGNATSHIDNRAIIQPYSLGTGPKQPEYQFAADNR
GYEPDSHANGKQQDVERDAPDGGHGGHGPPGKGGKGGKGRKKSVPLPEPTAPIVANFERAIELCGYGKFHYILLAICGLV
STSEEMDVISMSFILPSAECDLDLNTETKGWLNSIIFIGMMVGAYFWGSIADSFGRKKVLIVISFMNAFCIVASSFSQTY
SFFMLFRFLNGAALGGSGPVIWSYFAEFQPKAKRGSMLSFMAAFWTFGNLFVASLAWLIIPRTIGFTTPYFTYNSWRIFL
LVCSLPSFLVGFLLFYLPESPKFLLTRGKKDRALAIFRGIFVTNTKRRPDEYMVYDLEVDEKLLESNGNVKNKYSRMISG
MVDHSRALFKSPILRFTIVSITINFTFHIGYYGLLMWFPELFNRFEEYEKAFPDQSAGVCAVTDYVVNLAKEQSNNGTCS
SDIPQSVFMESLISLASALPANLLAILGMDMLGRKFFLIAGTMTAGICSALMYFVRSSVQNLVVSAIFSGAISAANAALD
CLITEVFPTKLRATGVAISMVAARLGGIIGNIVIAQLLDNYCPSPTFIVSGLLIGGGLMCLLLPNTTRKELN
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0070986
3243
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0070985
3291
FBtr0070984
3610
FBtr0340265
3808
FBtr0340266
3375
FBtr0340267
3743
FBtr0340268
3762
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0070945
632
FBpp0070944
632
FBpp0309231
632
FBpp0309232
632
FBpp0309233
632
FBpp0309234
632
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG3168-PB
Name Synonyms
Secondary FlyBase IDs
    References (2)