Open Close
General Information
Symbol
Dmel\Trf4-1-PE
Species
D. melanogaster
Annotation Symbol
CG11265-PE
FlyBase ID
FBpp0071159
Associated gene
Length (aa)
1001
Theoretical pI
7.52
Predicted MW (kDa)
108.7
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MDPFVGWFQKEQEGPSLCTWLKIWETNAQEMGALLNQQLQQATTINGSTSSSSSSSNSGNNNNNNNNNIINNTITNTTNN
TGNNSSAKPYLSRPYSSLNRVLNFRADSLEILQQQQQQQQLNGTTQRNSTNINTTSGGSTSSSADSTTNRDNNSPANSSS
TNGPGAGTGTSTGAGGTGTNSPATTASSTAATTTGPATSMSDTSNNPPQSTTTPASRTNSIYYNPSRKKRPENKAGGAHY
YMNNHMEMIAKYKGEPWRKPDYPYGEGVIGLHEEIEHFYQYVLPTPCEHAIRNEVVKRIEAVVHSIWPQAVVEIFGSFRT
GLFLPTSDIDLVVLGLWEKLPLRTLEFELVSRGIAEACTVRVLDKASVPIIKLTDRETQVKVDISFNMQSGVQSAELIKK
FKRDYPVLEKLVLVLKQFLLLRDLNEVFTGGISSYSLILMCISFLQMHPRGIYHDTANLGVLLLEFFELYGRRFNYMKIG
ISIKNGGRYMPKDELQRDMVDGHRPSLLCIEDPLTPGNDIGRSSYGVFQVQQAFKCAYRVLALAVSPLNLLGIDPRVNSI
LGRIIHITDDVIDYREWIRENFEHLVVVDRISPLPTAAPTAYATANGAPKYVIMPSGAVVQQLYHHPVQVPTAHGHSHAH
SHSHGHAHPGAHLCQPYVTGTTVSAVTTTTTMAVVTVGVSAGGVQQQQQQQNATAHTHSQQQTQNQSQSRHRRGSTSSGD
DSEDSKDGDVVETTSSAQEVVDIALSTPNGLANMSMPMPVHAVGMPASNSWSGNGNGNGNSSSSTGSSPEIAHIAAQEMD
PELEDQQQQQQHQETSGGNGFIRPGDVGTGSNRGGGDGSGGRNYNQRNNHNSSGYYHQQYYVPPPMQQQLSKSNSSSNYH
QQHHHSHSHGNHSHRQQHHHQQQHHHQQRPQHLRVGGGNRYQKSLGGSPIISAGNASNSSSNCSNSSSSSGSNNSRLPPL
RGTLVNSSSAISIISISSESSIASSSSSSSRSGQDQQRDER
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0071213
4400
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0071212
4205
FBtr0112963
3981
FBtr0112964
6507
FBtr0331723
3975
FBtr0331724
4238
FBtr0331725
6812
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0071158
1001
FBpp0111876
802
FBpp0111877
802
FBpp0304112
1001
FBpp0304113
1001
FBpp0304114
1001
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG11265-PE
Trf4-1-PE
Name Synonyms
Secondary FlyBase IDs
    References (2)