Open Close
General Information
Symbol
Dmel\Moe-PB
Species
D. melanogaster
Annotation Symbol
CG10701-PB
FlyBase ID
FBpp0071213
Associated gene
Length (aa)
649
Theoretical pI
6.02
Predicted MW (kDa)
76.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MVVVSDSRVRLPRYGGVSVKRKTLNVRVTTMDAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDSTWIKL
YKKPESPAIKTIKYLKRVKKYVDKKTADSNGVNHLETSEEDDDADDMTGSMPFSTWVMNQDVKKENPLQFRFRAKFYPED
VAEELIQDITLRLFYLQVKNAILTDEIYCPPETSVLLASYAVQARHGDHNKTTHTAGFLANDRLLPQRVIDQHKMSKDEW
EQSIMTWWQEHRSMLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTDLWLGVDALGLNIYEQDDRLTPKIGFPWSEIRNI
SFSEKKFIIKPIDKKAPDFMFFAPRVRINKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQEREKLQLALA
ARERAEKKQQEYEDRLKQMQEDMERSQRDLLEAQDMIRRLEEQLKQLQAAKDELELRQKELQAMLQRLEEAKNMEAVEKL
KLEEEIMAKQMEVQRIQDEVNAKDEETKRLQDEVEDARRKQVIAAEAAAALLAASTTPQHHHVAEDENENEEELTNGDAG
GDVSRDLDTDEHIKDPIEDRRTLAERNERLHDQLKALKQDLAQSRDETKETANDKIHRENVRQGRDKYKTLREIRKGNTK
RRVDQFENM
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0071270
2462
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0071271
2353
FBtr0071272
2027
FBtr0071269
3003
FBtr0071273
2283
FBtr0071274
2919
FBtr0071275
2295
FBtr0071276
2236
FBtr0071277
2282
FBtr0071278
2401
FBtr0308193
3064
FBtr0308194
2528
FBtr0331601
2995
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0071214
640
FBpp0071215
512
FBpp0071212
575
FBpp0089231
575
FBpp0089232
575
FBpp0089233
575
FBpp0089234
575
FBpp0089235
575
FBpp0089236
578
FBpp0300513
646
FBpp0300514
578
FBpp0303991
584
External Crossreferences and Linkouts ( 4 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG10701-PB
Name Synonyms
Secondary FlyBase IDs
    References (2)