Open Close
General Information
Symbol
Dmel\Slik-PB
Species
D. melanogaster
Annotation Symbol
CG4527-PB
FlyBase ID
FBpp0072271
Associated gene
Length (aa)
1703
Theoretical pI
6.60
Predicted MW (kDa)
192.1
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSFITNLKKVFHLGGGEAKKKRLYNNIKMDTDPAEFWEMVGELGDGAFGKVYKAQHKEQKRFAAAKMCQLEDEENLSDHM
VEIDILSEIKHPNIVELYEAFSIDDKLWMLIEYCDGGALDSIMVELEKPLTEPQIAYVCKHMTEGLTFLHRNKVIHRDLK
AGNVLLTMEGGVKLADFGVSAKNKHTMQKHDTFIGTPYWMAPELVLCETFRDNPYDHKVDIWSLGITLIELAQMEPPNSE
MSPMRVLLKIQKSEPPKLEQPSRWSKEFNDFLKKSLVKDPQVRPTTDVLMQHAFINRNLDAKPIKDLLLEYKAEVVEEVV
DDETEEPRNSALQLDLDDDSASLQSQDIDKLPGTPTSILRDAKEQSQPSSSLPIAAAATAAAAATTTTKATTPDRPNHTK
DDNAEAAAQQPPHTKVPAPAPPSSQQTPPPQVQQPPTPPAQPTAAVLQKKPEDVAAVAETSEKTESDKKHFVKKGKAPPP
PSPLGLANAKPAASDSQTSPKKLATPEPTSPVTTAIEVAIGQEAMEPKPQPPSPTASSIVSVQSVASSSSSGSVSNAVLS
SSTSLITINSDPPTPHHHQPLPPQPQHLILPNSLESVSQITVVTSTHPPVIIDNSVMPPQNEVIIVSNDMNKSTHLHESS
TDDDFPSLDDSLGDATTPPHKQSSMILAVNEPAGVVPAPPSQPQTSSTVHARKLDESEVLIVSPSYADDDSAYNTASGSH
SHDHSDHLMDTSHVSVVTVGDEGVKVKDSSNELVKRQPNGVGIVPEDVNIIVNRFKQEKRSPDSSLSENGSVRGRRGIEV
LVGGSGGSDVDSIGTNTSQESRHETDHNNKQQYPAAALMPPPPPSLTNNHNHETIDEEEEVVIRPKARVPAVVKSANAQG
LTKEEIELRNLRKKTRKRTRKFEIDGVQMTTTTSRVIYGDDENGRIYDDHDFRKQELRELKLLQKQEKKQQTELHLKEQQ
AKEQQDRRFEQERSSLEKTYEADMDMLARQHKQLVEKTEQTQENELRSSSKRIRSEQEQELKIFRENLKQEIRLLKQEVD
LFPKDKRKDEFKQRRSAMELDHEEKERAFLDSLKERHELLLRRLSEKHRDHLATINRNFLQQKQNAMRTREALLWELEEK
QLHERHQLSKRHVKELCFMQRHQMIIRHEKELDQVKRMLQRKEEDMVKKQTMEKRALPKRIRAERKARDLMFRESLRIST
NLDPEIERDRLKKFQEQEKKRYMQEERRFEVKHQKQLEELRATRESAIKELEQLQNEKRRALVEHEHSKLSEIDERLKGE
LREWREQLVPRKQELNRQIKLAIDQHEKRFGLVTNREEFEDQEVKLPAHLRNIYNERSSRILPRNTFIDPQNMPRSRSSL
LMMGGGGNRLSNFRGSAPDLSRSVPNTPIMHKQQRSQMIGDQVLEEDEEQMLSEQMKRASVATLPAQNQLRLITQLPANE
LVKVVTSTPPLNSAEDVNSKPSMSTFRGSTPPKTPDDLGLVTNRFSRLDTKAAAEASGVELRIHEGPVLTAHTQRLLHTT
SFAIKRPSLASRSSGRSSLSSAQSMYNINELSTRFTSDADLIFDSGRKAAALLDEVQPQLRSSVKPGHSRANGSVVSADS
AASSEDIYYDLYAAQYKLPRQLQQRLQQEVSPLIYPQCASQPFDTTQGPETGARRLEETFAQQLDEMETLYGGALIVSMP
SDTLQRDHFTGSTRSSLSSYSEG
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0072364
6419
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0072363
4863
FBtr0072366
6812
FBtr0100470
4642
FBtr0290019
5818
FBtr0332925
5405
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0072270
1300
FBpp0072273
1703
FBpp0099900
1342
FBpp0288458
1635
FBpp0305145
1365
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (4)
Reported As
Symbol Synonym
CG4527-PB
Plkk1-PB
Slik-PB
slik-PB
Name Synonyms
Secondary FlyBase IDs
    References (2)