Open Close
General Information
Symbol
Dmel\Pdk1-PD
Species
D. melanogaster
Annotation Symbol
CG1210-PD
FlyBase ID
FBpp0072366
Associated gene
Length (aa)
836
Theoretical pI
6.84
Predicted MW (kDa)
94.1
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MKCKSWSNKINNYVVRKIKSIKINGTQQQLQLPGSGASGIAAAAVITVASDCGENCSSNGTEHQQHFNIATTTATSATEA
TMPAMAKEKASATVSLGESNFRDINLKDLAVVVEAASRLHHQQNVCGCGAVSSTENNNNSRYGSSKYLTNGHTSPLAAAV
ASNSSSVATTPHCRMLHNCSLQQYQNDIRQQTEILDMLRQQHQQGYQSQQQQQQPQQQQEQQQQQEQSQQQQQLQNPAPR
RSPNDFIFGRYIGEGSYSIVYLAVDIHSRREYAIKVCEKRLILRERKQDYIKREREVMHQMTNVPGFVNLSCTFQDQRSL
YFVMTYARKGDMLPYINRVGSFDVACTRHYAAELLLACEHMHRRNVVHRDLKPENILLDEDMHTLIADFGSAKVMTAHER
ALATEHCSEQRRSNSDEDDEDSDRLENEDEDFYDRDSEELDDGDDEQQQEEMDSPRHRQRRYNRHRKASFVGTAQYVSPE
VLQNGPITPAADLWALGCIVYQMIAGLPPFRGSNDYVIFKEILDCAVDFPQGFDKDAEDLVRKLLRVDPRDRLGAQDEFG
YYESIRAHPFFAGIDWQTLRQQTPPPIYPYLPGVSQDEDFRSSYTVPGDLEPGLDERQISRLLSAELGVGSSVAMPVKRS
TAKNSFDLNDAEKLQRLEQQKTDKWHVFADGEVILKKGFVNKRKGLFARKRMLLLTTGPRLIYIDPVQMIKKGEIPWSPD
LRAEYKNFKIFFVHTPNRTYYLDDPEGYAIHWSEAIENMRKLAYGDPSSTSAVSCSSGSSNSLAVISNSSAASSSNSPTV
KRSSPVNAPQASTASDNRTLGSTRTGTSPSKKTASK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0072464
3706
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0072465
3986
FBtr0072470
3300
FBtr0072468
2756
FBtr0072471
3350
FBtr0072467
4162
FBtr0072469
2428
FBtr0072466
4347
FBtr0333218
4959
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0072367
755
FBpp0072372
539
FBpp0072370
819
FBpp0072373
539
FBpp0072369
755
FBpp0072371
539
FBpp0072368
755
FBpp0305420
836
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (3)
Reported As
Symbol Synonym
CG1210-PD
Pdk1-PD
Pk61C-PD
Name Synonyms
Secondary FlyBase IDs
    References (2)