Open Close
General Information
Symbol
Dmel\Rap1-PA
Species
D. melanogaster
Annotation Symbol
CG1956-PA
FlyBase ID
FBpp0072746
Associated gene
Length (aa)
184
Theoretical pI
6.58
Predicted MW (kDa)
20.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMRDLYMKNGQGFVL
VYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELGKNLATQFNCAFMETSAKAKVNVNDIFYDL
VRQINKKSPEKKQKKPKKSLCVLL
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0072867
2741
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0303154
2872
FBtr0332671
2702
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0292253
184
FBpp0304917
184
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (3)
Reported As
Symbol Synonym
CG1956-PA
Rap1-PA
Name Synonyms
Secondary FlyBase IDs
    References (1)