Open Close
General Information
Symbol
Dmel\RpL28-PB
Species
D. melanogaster
Annotation Symbol
CG12740-PB
FlyBase ID
FBpp0072957
Associated gene
Length (aa)
144
Theoretical pI
11.74
Predicted MW (kDa)
16.0
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MATSSHLNWLIIRNNNAFLLKKRDVKKPFSTEPNNLASVSSYRYSGIVHKKTLGVVPAADKKGFTAVLKKGKYAQRPAKN
TVRVDFKAGPRRSLKKLKNLLIGSKYRKDLTQAALRRASAVLRSQKPAPVKGKKAEFAKGKKPE
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0073095
887
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0073097
547
FBtr0073098
656
FBtr0302300
650
FBtr0302301
624
FBtr0306567
851
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0072959
144
FBpp0072960
144
FBpp0291506
144
FBpp0291507
144
FBpp0297522
144
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG12740-PB
RpL28-PB
Name Synonyms
Secondary FlyBase IDs
    References (1)