Open Close
General Information
Symbol
Dmel\Ork1-PB
Species
D. melanogaster
Annotation Symbol
CG1615-PB
FlyBase ID
FBpp0073260
Associated gene
Length (aa)
1001
Theoretical pI
9.96
Predicted MW (kDa)
109.3
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSPNRWILLLIFYISYLMFGAAIYYHIEHGEEKISRAEQRKAQIAINEYLLEELGDKNTTTQDEILQRISDYCDKPVTLP
PTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGIPVNGILFAGLGEYFGRTFEAIYRRYKKYKM
STDMHYVPPQLGLITTVVIALIPGIALFLLLPSWVFTYFENWPYSISLYYSYVTTTTIGFGDYVPTFGANQPKEFGGWFV
VYQIFVIVWFIFSLGYLVMIMTFITRGLQSKKLAYLEQQLSSNLKATQNRIWSGVTKDVGYLRRMLNELYILKVKPVYTD
VDIAYTLPRSNSCPDLSMYRVEPAPIPSRKRAFSVCADMVAAQREAGMVHANSDTELSKLDREKTFETAEAYRQTTDLLA
KVVNALATVKPPPAEQEDAALYGGYHGFSDSQILASEWSFSTVNEFTSPRRPRARACSDFNLEAPRWQSERPLRSSHNEW
TWSGDNQQIQEAFNQRYKGQQRANGAANSTMVHLEPDALEEQLKKQSPGAGRVKKFSMPDGLRRLFPFQKKRPSQDLERK
LSVVSVPEGVISQQARSPLDYYSNTVTAASSQSYLRNGRGPPPPFESNGSLASGGGGLTNMGFQMEDGATPPSALGGGAY
QRKAAAGKRRRESIYTQNQAPSARRGSMYPPTAHALAQMQMRRGSLATSGSGSAAMAAVAARRGSLFPATASASSLTSAP
RRSSIFSVTSEKDMNVLEQTTIADLIRALEVVHTHAVLDEQQQAAAAGGAAGGGGISRGSRKQRKMGNAGLEPPQLPPIL
SLFAGDQTRTLQAAAANRLYARRSTIVGISPTGGAATAPAARSLLEPPPSYTERAANQSQITAGPSNAPTVQSKFRRRFS
VRPTALQIPPGQAPPPGASLMEQSSQTALQRRLSLRPSPLARELSPTSPPGGSGSALPAGAIDESGGTSAQRLLPLPAGT
RPSTSSTHSPLSRIVQISQAQRKSSMPSAAATGSSGAPAEK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0073404
3979
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0073405
4100
FBtr0343584
4033
FBtr0346304
4409
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0073261
1001
FBpp0310181
1019
FBpp0312045
1001
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG1615-PB
Name Synonyms
Secondary FlyBase IDs
    References (2)