Open Close
General Information
Symbol
Dmel\hep-PA
Species
D. melanogaster
Annotation Symbol
CG4353-PA
FlyBase ID
FBpp0073578
Associated gene
Length (aa)
1178
Theoretical pI
10.05
Predicted MW (kDa)
125.1
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSTIEFETIGSRLQSLEAKLQAQNESHDQIVLSGARGPVVSGSVPSARVPPLATSASAATSATHAPSLGAGSVSGSGISI
AQRPAPPVPHATPFGSASASSSSSSASAFASAAPATGTFGGTYTPPTTRVSRATPTLPMLSSGPGGGLNRTRPVILPLPT
PPHPPVSETDMKLKIIMEQTGKLNINGRQYPTDINDLKHLGDLGNGTSGNVVKMMHLSSNTIIAVKQMRRTGNAEENKRI
LMDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLKLSKKPVPEQILGKVTVATVNALSYLKDKHGVIHRD
VKPSNILIDERGNIKLCDFGISGRLVDSKANTRSAGCAAYMAPERIDPKKPKYDIRADVWSLGITLVELATARSPYEGCN
TDFEVLTKVLDSEPPCLPYGEGYNFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFIRIYESAKVDVPNWFQSIKDNRLRA
NGDPTLQRATATGSAIGSGAGSLAGSGSGSAGGAVKYGRATTYAGQSPTNPQKTIKPTQIPSYQQQQSQFFMQSATQLPQ
TTTTTPTATTNCFGGSGNGNGRGNGSGGSGNGSGSSSSASPLSPPSAGIGDLNRLYRKSPFMQRKLSNGSHHPHYKYNDE
SPKKESMFSSIGQSILRNLTTSPFSQKKHNSTATTIPLPHNNQTLITDAATAAAAAATATTPPNIAATVLTTTPTTTPTW
RLPTENSQAYDSCDSSSNATTTTLNLGLSSPSPSLPRKQFPTESPTLQLTSQQQQQPQRLQPGNQSPIVLQRFYHQQNQL
REKEAAERYQQQRQQPPVGVTSTNPFHSNYVPPPPSTHSTSSQSSTQSTCSQIAINPASISPSSGSGTGNMAGLGIGSAP
ASGLGAAGHFGAGGTGEQLQYQPLPIAAEATGTSPTLQSRSPEQQSDYGGNGNMVASKLSKLYARRQLLGQSSSSGASNS
SLDGCSREQHDAGWFNTLAGAMKRQFATYVKTQLNSTATSPVASSMDRDQEPVHPQPPAYRSVVNNGSGGKSYYYRTLSA
ASSSSNTSQSTSPTTEPLPGGGTSSFLRRYASSGPGGSISTPPSPHILAGLDRRHRSPDPPPRYNRGQSPLLLRKNLLEL
SGQPPGSPLLHRRYVSASPPLPPPRRGSESVPGSPQHFRTRIHYTPEPQRRIYRTIDQ
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0073747
4893
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0073748
2738
FBtr0330396
5344
FBtr0330397
5689
FBtr0340303
5344
FBtr0479992
4893
FBtr0479993
4893
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0073579
492
FBpp0303422
1162
FBpp0303423
492
FBpp0309264
1153
FBpp0428279
1187
FBpp0428280
1294
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG4353-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)