Open Close
General Information
Symbol
Dmel\dpr8-PA
Species
D. melanogaster
Annotation Symbol
CG32600-PA
FlyBase ID
FBpp0073730
Associated gene
Length (aa)
344
Theoretical pI
7.94
Predicted MW (kDa)
37.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSTHWIIFLGILCLLAGCTDGASKRFFTDFLQDLPTPGTGGPTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHR
DIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIGGPELHINRG
STINLTCIVKFAPEPPPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSVRVHI
VDGEHPAAMHTGNNGNSTASQPPVLLPLVLLTCSTLMLLQLVASCSTLVPATPPGCRTVQQASTFAEEKAMGQRSNRNCQ
DLQELEESQDLRRRGVERSAVPGT
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0073913
4958
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0343518
4837
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0310122
344
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG32600-PA
Name Synonyms
Secondary FlyBase IDs
    References (1)