Open Close
General Information
Symbol
Dmel\Flo2-PF
Species
D. melanogaster
Annotation Symbol
CG32593-PF
FlyBase ID
FBpp0073769
Associated gene
Length (aa)
425
Theoretical pI
5.64
Predicted MW (kDa)
46.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MGNIHTTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVTGVAQCKIMKA
DELLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDD
VQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLA
YELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIR
KIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLIGGNDNITNDVTRLVAQ
LPPSINALTGVDLSKVLSKIPGAKA
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0073952
2892
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0073949
2819
FBtr0073950
2780
FBtr0073954
1811
FBtr0073951
2931
FBtr0300434
2762
FBtr0300435
2429
FBtr0330214
2240
FBtr0330215
3212
FBtr0330216
3160
FBtr0330217
2780
FBtr0347266
2602
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0073766
438
FBpp0073767
425
FBpp0073771
281
FBpp0073768
438
FBpp0289663
340
FBpp0289664
281
FBpp0303247
435
FBpp0303248
448
FBpp0303249
438
FBpp0303250
440
FBpp0312521
356
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (3)
Reported As
Symbol Synonym
CG32593-PF
Flo-2-PF
Flo2-PF
Name Synonyms
Secondary FlyBase IDs
    References (2)