Polypeptide Dmel\Flo-2-PD

General Information
Symbol	Dmel\Flo-2-PD	Species	D. melanogaster
Annotation Symbol	CG32593-PD	FlyBase ID	FBpp0073771
Associated gene	Dmel\Flo-2

Length (aa)	281	Theoretical pI	5.34
Predicted MW (kDa)	31.0

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIRE AECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQ AAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEA FRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMK AHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLIGGNDNITNDV TRLVAQLPPSINALTGVDLSKVLSKIPGAKA
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) Flo-2-RD FBtr0073954 1811
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) Flo-2-RA FBtr0073949 2821 Flo-2-RB FBtr0073950 2782 Flo-2-RC FBtr0073953 2602 Flo-2-RE FBtr0073951 2933 Flo-2-RF FBtr0073952 2894 Flo-2-RG FBtr0300434 2762 Flo-2-RH FBtr0300435 2429 Flo-2-RI FBtr0330214 2242 Flo-2-RJ FBtr0330215 2851 Flo-2-RK FBtr0330216 2821 Flo-2-RL FBtr0330217 2894
Other Polypeptides
	Name FlyBase ID Length (aa) Flo-2-PA FBpp0073766 438 Flo-2-PB FBpp0073767 425 Flo-2-PC FBpp0073770 401 Flo-2-PE FBpp0073768 438 Flo-2-PF FBpp0073769 425 Flo-2-PG FBpp0289663 340 Flo-2-PH FBpp0289664 281 Flo-2-PI FBpp0303247 435 Flo-2-PJ FBpp0303248 448 Flo-2-PK FBpp0303249 438 Flo-2-PL FBpp0303250 440
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_727814 DDBJ / EMBL / GenBank • AAN09348
Synonyms
	CG32593-PD Flo-2-PD
References ( 2 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453] FlyBase, 1996-, FlyBase inference based on genome sequence analysis. FlyBase inference based on genome sequence analysis. [FBrf0104946]