Open Close
General Information
Symbol
Dmel\vap-PB
Species
D. melanogaster
Annotation Symbol
CG9209-PB
FlyBase ID
FBpp0073945
Associated gene
Length (aa)
954
Theoretical pI
6.85
Predicted MW (kDa)
107.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MADLIHLGNIDVVIQKDKPGSPTGCSDDGNLAGLGGMTGLGGIMAPGGIDLGDLAQELDHDEFDGPHMLNGERPAIIAPP
ESEWYHGRLDRYSAESRLRGSSKLGSYLVRESDRKPGSYVLSYYGRTGINHFRITAVCGDFYIGGRQFISLSDLVGYYTS
CSDLLKRERLAIPVAPPEPVNDKKRVVAILPYTKMPETDELSFQKGDIFFVHNDMGDGWLWVTAHRTGEQGMIFRELVDD
LDVSIDPNTVFPWFHPNCTKNEAVDMLVKAGPGSFLVRPSDNSPGDYSLFFHINNQIQRFRIEKKGVRYLMGGRTFECLD
AVINRYRKEQIVEGHSLNHPVVNGIQPEFNQQYVVEKAAEKIYATLRECRDQIGLKKIKGIKHHGHLNKKSDKTTKWKQL
YFALINDGSETQLCFYDNPKKTKPKGLIDLSCAYLYQCHDSLWERPYCFQIVERALPCLATVTYLCAPSQESYVEWINSL
KAQCDSQLSRAQKKVSRLRELRCLNLHVLEAHRLPFKLVPHPYCSISLNQVKVGKTRVKIAPEPVWEEEFVLDDVPPDVV
SLTITLISRGKRGKDSEVAELTIDLSSLKNGQETEGWYQLTGMTPMGEWGSLRLRMRYLDDLIMPCEEYSPLQQLLLESE
LYAVKALAELCHNDRVPLATALLRVFRQEKRETELIRMLCQAEVTRENETTTLFRGASLATTLMDLYMRTECSGFLQSAV
SETVQRILESKQSAELNPTKMDVNDDACTNAEFLLQILDLVTQSIFTSPDACPRNVRFICSCLQKAVMAKWPTERLVRTR
VVSGFIFLRLLCPALLNPRQFGLVSETPPMAATRSLVMVAKCLQNLANLIEFGGKEQYMEVVNPFILKNKERMIVFLDQL
SSVNDPNQPLGMFVEQSTNLNSQDTGRELATLHHICVSHSQELHELSNILSIKKLVTVTDMLTKHKLKYREMIS
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0074140
3426
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0074142
3728
FBtr0074141
3543
FBtr0074143
3649
FBtr0340415
4340
FBtr0340416
3845
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0089147
954
FBpp0073946
954
FBpp0089148
954
FBpp0309361
954
FBpp0309362
954
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG9209-PB
Name Synonyms
Secondary FlyBase IDs
    References (2)