Open Close
General Information
Symbol
Dmel\CG4928-PB
Species
D. melanogaster
Annotation Symbol
CG4928-PB
FlyBase ID
FBpp0074119
Associated gene
Length (aa)
538
Theoretical pI
5.90
Predicted MW (kDa)
58.7
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MTGFTNAGFENDEPVKPKAGFEPDTASLREKVVLNPGEKWRILKNISIISIAFMVQFTAFQGTANLQSSINAKDGLGTVS
LSAIYAALVVSCIFLPTLIIRKLTVKWTLVCSMLCYAPYIAFQLFPRFYTLVPAGILVGMGAAPMWASKATYLTQVGQVY
AKITEQAVDAIIVRFFGFFFLAWQSAELWGNLISSLVLSSGAHGGGSSSNTTVSEEDLQFCGANFCTTGSGGHGNLERPP
EDEIFEISMIYLSCIVAAVCIIAFFLDPLKRYGEKRKGSNSAAELSGLQLLSATFRQMKKPNLQLLIPITVFIGMEQAFI
GADFTQAYVACALGVNKIGFVMICFGVVNALCSILFGSVMKYIGRTPIIVLGAVVHFTLITVELFWRPNPDNPIIFYAMS
GLWGVGDAVWQTQINGLYGLLFRRNKEAAFSNYRLWESAGFVIAYAYATTLCTQMKLYILLAVLTLGCIGYVIVEILYRK
KQRKLKKQEKLEAAEKEKEAAAAAAAAALAAAEAGADGVEETDDELDDLEEDIVVTRL
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0074345
3410
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0074344
3472
FBtr0342973
1772
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0074118
538
FBpp0309738
495
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG4928-PB
Name Synonyms
Secondary FlyBase IDs
    References (2)