Open Close
General Information
Symbol
Dmel\CG5004-PA
Species
D. melanogaster
Annotation Symbol
CG5004-PA
FlyBase ID
FBpp0074160
Associated gene
Length (aa)
1247
Theoretical pI
8.84
Predicted MW (kDa)
136.8
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSLTKKDPSLRVAASDPHLVSLGGGRLSTAVTIHYIHIGDTTIGSAASCSISLNGSGVRPLHCTIYRSDANEVTLVPEKD
SRLLIDGAPILEETKLSQGAMITIGNSNYLRFNNPDEAQMMRSAMGSNERISMPQIDFTQSARQAHELSQSLELESFYES
IINPINNPSTYELECPKVFSSDLVTVNMPAKDVLGQKYASFARNLAENHRNEKQLNNQYAKGVGSNGGYWNVPSNAAIYK
EQHQQQHQQAPQDLLTKVNNDRYDRYPKAGGLQIYSMNGVNSDINNGPATGNNSGTGGGAELEDMLKICTEYADRNNSMP
STHNVSSTSSITSSPIVQNRIKTNGSLPRDKNKSPFPQQAGVASSANISLLSSSSGYENVRLLGPNRVEINGQIHVPASA
GDGGSSSGVSSNALAPTAAVRASHENLNQNHSATTGGKYVPQSPRTKIRTNCMSPKKDVSFGNAFALAISPPPLASSAVV
STSKPIPIPSMVKPPLAPKPPAPNQQRDYEQLFKSFERKQQQLDRMVPAKRSNKNINNLTLNLQSVESQTQSPKPSRKPA
PAPRSIHLEQRQRRELIQRRKQLKRELAELPPSAGIEGLELKLGEQPLAPSASPRLQLQALQNRVCRLEAQRNATRVMEE
NQQAKLKQSIEIKQDQLKKLRAMLKQKPNNACLKEELQLVCESLESDRKTFEDLEFQYFEEESEHHASHEEFKRQEQRLM
LEAELAALRIQIGPDEEEPGSPTSPGSTGSNLVNGVMSQSLFGSAELLCPKRRNQEDLMSKSVNENMFYNHKIEANTSTP
KRLPLQLFEDLAGGSCEQISFNLSLQGDRFEVNPLERRVPSQDDIDRSCKVANDAPISASQGASTKIFDSIMEIERNRKL
LLAQQGHQVIEHERQKMYDLKKKSHDEARTQYLLSTQQSMEQQRQLESDANGGKDAKLFEKTELQKLNQKPGEPVDDQVQ
KIAGDKENNVQNRKSTGSSPTTTTTTTTGGGTTPQQQRHSQPELEHHAIALGIGGGGSGGAGGANQMVARSPRPLSEANN
CDATIEAPKFANGMDSSASPAVADNKRASSNSQDTASAGSGSGNSGSGGSTASDRKRVLPKHQRPLTRYLPIFSPDLNLR
HHIETAGHQIDPCPHVFVDAHSCRGYLHKLGATFHAWSRRWFVLDRQRSALIYYSDKSERKPRGGAYFATIDEVYLDHLN
ASKSGRPHCTFIVKTKKRSYNLQAASDSAARIWIDAIITGAQGNLDY
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0074386
5088
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0302375
4563
FBtr0302376
4573
FBtr0302377
1967
FBtr0343201
1800
FBtr0346797
2075
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0291570
1147
FBpp0291571
1147
FBpp0291572
328
FBpp0309890
277
FBpp0312375
221
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG5004-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)