Open Close
General Information
Symbol
Dmel\CG15814-PC
Species
D. melanogaster
Annotation Symbol
CG15814-PC
FlyBase ID
FBpp0074244
Associated gene
Length (aa)
321
Theoretical pI
8.21
Predicted MW (kDa)
37.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MHQEHMDLHEPVDLNKSLDEMTPEERMRAQHQLMVEKHRGHDAMHSEMVIILFVTLVIAQIILVEWKKRHYRSYAFVTLL
AMWLIPLIISCSFGWLRFIIIWLVFTCITALVMRRAISKPIQGTTPRLVYKWFYFIYKLSYGLGLVGYLVIIAAFLGMNY
MFSQPPNTWMDVGLMFCFYGLYIGVLGRDISEICSDKMAAAIGYYTPQGIPTRHLDQNVCAVCGNQLLVSEKEEGVIENT
YKLSCNHVFHEFCIRGWCIVGKKQTCPYCKEKVDLQKMFRNPWEKPHVLYGRLLDWIRWLVAWQPLIFFIVQGINWMLGL
E
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0074470
1740
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0074469
1884
FBtr0074468
1664
FBtr0074471
1487
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0074243
321
FBpp0074242
321
FBpp0074245
301
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG15814-PC
Name Synonyms
Secondary FlyBase IDs
    References (2)