Polypeptide Dmel\Pfrx-PA

General Information
Symbol	Dmel\Pfrx-PA	Species	D. melanogaster
Annotation Symbol	CG3400-PA	FlyBase ID	FBpp0074483
Associated gene	Dmel\Pfrx

Length (aa)	536	Theoretical pI	6.64
Predicted MW (kDa)	60.8

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MDMPYNTSPSLRVRTTSLNQLKKTADLAIENELHVCPSVMSEELRKLLPP TSETVMTKPFPIRGERTIADCTTPHVIAMVGLPARGKTFISKKLARYLNW IGISTRVFNLGEYRRHATTAYKSHEFFRADNEEAMAIRNRCANQALHDSC DWLLSGQGSIAVFDATNSTRDRRQLIHDIVVKQHGFRLFFVESICDDPQI IEQNILEVKVSSPDYLNMNTELVVRDFLQRIEHYEERYQPIDEVTESHLS FMKVYNAGKKVVVYNNEGHVESRIVYYLMNIHITPRTIYLTRHGESEYNL SGLIGGDSNLSARGHQYANALSTFIAQQQIDGLRVWTSWMKRAIQTVADV KAPQERWKALNEIDAGHCEEMTYEQIKEKFPEEFKARDVNKFAYRYPRGE SYEDLVARLEPVIMELERQGNVLVVSHQAVLRCLFAYFLDKSADELPYLY VPLHTVIKLTPVAYGCKVEHIKLPIDAVDTHRPKPKIPGDVSEPGLDGLS GELVAPDGVGKVLIVGDDVATATNGNGGRVDVQAHQ
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) Pfrx-RA FBtr0074714 2981
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) Pfrx-RB FBtr0074717 3376 Pfrx-RD FBtr0074719 2983 Pfrx-RE FBtr0074720 3193 Pfrx-RF FBtr0074713 2912 Pfrx-RG FBtr0074716 2930 Pfrx-RH FBtr0074718 2980 Pfrx-RI FBtr0074715 2978 Pfrx-RJ FBtr0307192 3061 Pfrx-RK FBtr0307193 3197 Pfrx-RL FBtr0307194 3383 Pfrx-RM FBtr0339439 3031 Pfrx-RN FBtr0339440 3373
Other Polypeptides
	Name FlyBase ID Length (aa) Pfrx-PB FBpp0074486 716 Pfrx-PD FBpp0074488 536 Pfrx-PE FBpp0074489 536 Pfrx-PF FBpp0074482 536 Pfrx-PG FBpp0074485 716 Pfrx-PH FBpp0074487 536 Pfrx-PI FBpp0074484 536 Pfrx-PJ FBpp0298021 536 Pfrx-PK FBpp0298022 536 Pfrx-PL FBpp0298023 536 Pfrx-PM FBpp0308526 536 Pfrx-PN FBpp0308527 715
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_728249 DDBJ / EMBL / GenBank • AAN09491
Synonyms
	CG3400-PA Pfrx-PA
References ( 2 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453] FlyBase, 1996-, FlyBase inference based on genome sequence analysis. FlyBase inference based on genome sequence analysis. [FBrf0104946]