Open Close
General Information
Symbol
Dmel\CG14207-PB
Species
D. melanogaster
Annotation Symbol
CG14207-PB
FlyBase ID
FBpp0074503
Associated gene
Length (aa)
192
Theoretical pI
6.54
Predicted MW (kDa)
21.8
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MAEANKRNIPIKLGDFSVIDTEFSNIRERFDSEMRKMEEEMAKFRHELMNREANFFESTSSTKKTTTTSSTTNSALPSRI
PKQQNYVSDISSPLIQDEGDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKSVYREYNREFLLPKGVNPES
IRSSLSKDGVLTVDAPLPALTAGETLIPIAHK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0074734
1267
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0074733
1240
FBtr0307161
753
FBtr0345918
1380
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0074502
183
FBpp0297990
154
FBpp0311833
183
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG14207-PB
HspB8-PB
Name Synonyms
Secondary FlyBase IDs
    References (2)