Open Close
General Information
Symbol
Dmel\wnd-PB
Species
D. melanogaster
Annotation Symbol
CG8789-PB
FlyBase ID
FBpp0074732
Associated gene
Length (aa)
977
Theoretical pI
7.78
Predicted MW (kDa)
109.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MQPFSDSLSKSRDDLVTAASRQQQQLHGRRRHHGSSPNLSLDQTDNLRRSMACLQDEFGHLGIAATDLPFKSSDLDSPPR
LQHHNNYAEITDSSAENTCQQRWPPHVGGAGAAFGHPDKPIGWMYGLLGCMKPVLSFIGKTGVIEVKSQRSEDWQIPFES
ITELEWLGSGAQGAVFSGRLKNETVAVKKVKELKETDIKHLRKLDHENIIKFKGVCTQSPVFCIIMEFCPYGPLQNILKE
EQVMLPSRLVSWSKQIALGMQYLHSHKIIHRDLKSPNILISTNEVVKISDFGTSREWNEISTKMSFAGTVAWMAPEVIRN
EPCSEKVDIWSYGVVLWEMLTCEIPYKDVDSSAIIWGVGNNSLKLLVPSTCPEGFKLLVKLCWKSKPRNRPSFRQILSHL
DIAGPELLRKTEKQYFETQKSWKEEVRSHLKEITQNGTNIHKYEQDLIKRRTAEWRHAQDIRMVYEDKLQKTNQLFFELS
ECMSQLQEKEKEIAERERKLPGSGYKPNRRFGNTIRKMQHYRRRLNPAPAAIQQQSTTPDPETTPESPVKCMLYAQLDSN
CQPKSYLANIIPSSGLGAPMPNKNKKVFRHRRNASGSFGAPPKYSPTRDRRYQSEPENRKVQLVERQTQTDAMDVSETDI
SPSAEAPRSQPIDVPVPNHRQLPLQLQRVQKIAQAQARARSGSTSSAAGAVNPACPSNGNSLSTSELTYQDACSSPDQLI
DDVMNSNERLDMTECCSDNENLERLGRKVIEFINENRLSIQSNTNSVSNADNGNGGASPLELRESGNSPCLSRCSSTHSK
RRKHPLGDNPNGSSIGNANGESHEQDSWSDEEGETTDYKYALRRRSIGRQPIARGMRPRRSYKAPLSQKIAIHKRNVVIV
SDEEENTSEYSHSPSSQHSTLESNTDIADMKKTQATSTSSNSYSEPEDDSSDSSDEEQGNRPTEAKAEGPALPMGAVRSS
DIISIPTFEADGAVNMV
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0074964
4307
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0074963
4384
FBtr0074965
4512
FBtr0302513
3645
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0074731
977
FBpp0074733
977
FBpp0291675
950
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG8789-PB
wnd-PB
Name Synonyms
Secondary FlyBase IDs
    References (2)