Open Close
General Information
Symbol
Dmel\brm-PA
Species
D. melanogaster
Annotation Symbol
CG5942-PA
FlyBase ID
FBpp0075280
Associated gene
Length (aa)
1638
Theoretical pI
7.60
Predicted MW (kDa)
185.1
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MASPSPANSPMPPPQAPSPMAPPSQSPAPSPHSPYPHQQPGPLQGPPPPGHPGAYGHPMQHGPPGQGPPGHHMPPHHQGM
IFSKGPHMGMQMPPTGPNMSPYQTHGMPPNAPTQPCIVSPGGPPGGPPPPERSSQENLHALQRAIDSMEEKGLQEDPRYS
QLLAMRATSKHQHLNGNQVNLLRTQITAYRLLARNKPISMQMQQALQAAQQQPPPGPPIGPPGAPGGPPPGSQHAGQPPV
PPQQQQQPPPSAGTPPQCSTPPASNPYGPPVPGQKMQVAPPPPHMQQGQPLPPQPPQVGGPPPIQQQQPPQQQQQQSQPP
PPEPHQHQLPNGGKPLSMGPSGGQPLIPSSPMQPQVRGTLPGMPPGSQVPQPGGGPQRQVPPAGMPMPKPNRITTVAKPV
GLDPITLLQERENRIAARISLRMQELQRLPATMSEDLRLQAAIELRALRVLNFQRQLRMEFVQCTRRDTTLETALNIKLY
KRTKRQGLREARATEKLEKQQKLEAERKRRQKHLEFLAAVLQHGKDLREFHRNNKAQLARMNKAVMNHHANAEREQKKEQ
ERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLSQTDEYISNLTQMVKQHKDDQMKKKEEEGKRLIQFKKELLMSGEY
IGIDEGSIVADMRVHVVEQCTGKKLTGDDAPMLKHLHRWLNMHPGWDWIDDEEDSCGSNDDHKPKVEEQPTATEDATDKA
QATGNDEDAKDLITKAKVEDDEYRTEEQTYYSIAHTIHEKVVEQASIMVNGTLKEYQIKGLEWLVSLYNNNLNGILADEM
GLGKTIQTISLVTYLMDRKKVMGPYLIIVPLSTLPNWVLEFEKWAPAVGVVSYKGSPQGRRLLQNQMRATKFNVLLTTYE
YVIKDKAVLAKIQWKYMIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQ
WFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMSALQRVLYKHMQSKGVLLTDG
SEKGKHGKGGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDHTGGHGVVSGPDLYRVSGKFELLDRILPKLKATNHRVLLF
CQMTQCMTIIEDYLGWRQFGYLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQ
DLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVIQAGMFDQKSTGSERQQFLQTILHQDDNEEEEEN
EVPDDEMINMMIARSEEEIEIFKRMDAERKKEDEEIHPGRERLIDESELPDWLTKDDDEVERFHYQYDEDTILGRGSRQR
KEVDYTDSLTEKEWLKAIDDGAEFDEEEEEDDSKRKRRKRKNRKEESDDDSLILKRRRRQNLDKRSKKQMHKIMSAVIKH
NQDGRTLSEPFMKLPSRQRLPDYYEIIKRPVDIKKILQRIEDCKYADLNELEKDFMQLCQNAQIYNEEASLIYLDSIALQ
KVFVGARQRITAAADAAAVAAGDNTGEAHGNGGSDNSDNDDDDGGDDGSDDEEIATTSAAAVKMKLKLNKSLASAPATPT
QSSSNVSSGAATTSKKQTRRKRSQKKYTISDDDDDDMD
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0075525
5339
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0075526
5553
FBtr0075523
5327
FBtr0075524
5322
FBtr0330160
5339
FBtr0333580
5351
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0075281
1638
FBpp0075278
1634
FBpp0075279
1634
FBpp0303193
1658
FBpp0305757
1642
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG5942-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)