Open Close
General Information
Symbol
Dmel\dop-PA
Species
D. melanogaster
Annotation Symbol
CG6498-PA
FlyBase ID
FBpp0075315
Associated gene
Length (aa)
2139
Theoretical pI
8.55
Predicted MW (kDa)
225.5
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSRQEGAASRPADGATGPVASSSSSTSSNHSVSAVLGSKISTSTPQKNDEHQEQEFINQSVASEIEAMSISDSASAESSS
GATATATATMSGSPVPKRHLSTANLSRIRPQSSYSARVLIFDDSDQEAAAAAAALAAASSSCNSSVKSCSGLELLPTSPA
KLSIGNDSTNGSSMMRNLNLTKSSSGGLSGSSSSLHSRGYTALLRKISYQQHTNSLRAVSGETSNLLRMRHSSLGKSAPC
LTGNYFRHELTAPLPVQPPGFGASPLGGHNISRSGSCAGIGLAKHHHHHHLHGVVMRGSAGGGAGSGGGSSSGVAHHRLS
LVTNSAAVAAAGGSRTHSPYSASPVDSPRLNSPMPFAFAPIKRIASCRGVVADGRRWSVASLPSSGYGTTPGSSNLSSQC
SSQEGLNQLAHNIPPGVQEADAAAVAAGACCAEHLKQHCPKHCALLLAVSQKQLTPQPPKPTQLQPQKSMTAACVNCCAE
LSVTCGGQQAGGGAANGGSSANSSGSSAMQVGGRMSPYFRPRSRSLSSPSRSPIVDNEIAVMNTLYKERFPKATQQMEER
LKLFINENKSAACNSFRDSQPIVRFVHHQVLEMARDCLHKSEAKLITSQYFYELSENLERLLVETKEKSPEAAAELNGVI
KKLLLIISRPARLLECLEFDPQEFYELLEAAEGHAKAMPVIKADIPQYIIHKLGLNRDPIAELQQELRETQQMCSEQVTV
DADPLHPGGSLLLNSPLTSAAKQLSSLALDAIAMDSGSGTATPQQPPQTPVATCDTAPSFALAISQMNEEKGGSSSAVGG
GSSSKVAGAEGITGGSAATATGSGAQQPSPQENDFDIVKLISNGAYGAVYLVKHKTTRQRFAMKKINKNNLILRNQVEQV
FAERDILSFADNPFVVSMYCSFETKKHLCLVMEYVEGGDCGTLLKNIGPLPADMARFYFAETVLAVEYLHSYGIVHRDLK
PDNLLITALGHIKLTDFGLSKMGLMSLATNLYEGYIDSETRQFSDKQVYGTPEYIAPEVILRQGYGKPVDWWSMGIILYE
FLIGCVPFFGETTEELFAHTVNDDIEWPDSEDWPVQAEAKDIISQLLQQNPRDRLGTQSGALEMKEHEYFLGMDWNSLLR
QKAEFVPQLSHDDDTSYFDTRMDRYNHDLGGEDTDDTDDTPVFGSFNSYTPQYRKQHYSWSRHATPTSTDGAKPTGPPPL
SSLPSRAQETPAATVGATSTGALPKLKSGMGSGSGSGSGSGSGSASHDGVVNKFLNTPQLRKLDLSSSCLKVPSTPDADY
LPELLHNVTIGNDAELRMLKHYLQQPNPGATQRMQQRHSMPPNTTTIISTPATPPPTQTQATMAATPPTATVGSFSRSTP
ESSQTDSDDFSPQINRKRKGVCARDILPRFSISIEDETISAGSSSTENMNLPREQSPLALQHQPKSMDGSTSGSSVKHHR
SRSIVKSASALGLSLMTSLDNSQLAAQLCGIQSPGGGGNGSSTASSRDTSPCRELSPLVTNLKPPIIIRRGPRGFGFTVH
TIRVYYGDTDFYTMHHLVMAVDEGSPAFEAGLRPADLITHVNGEAVQGLFHTQVLQLLLSGGEHVTLRATPLEHTSIQSG
GRKRDLMQSKLAKKGVNRQKKQTKREHDKKRKTSLFRRISSKRANAEMQQYSAGTSSPTTPSARNLSPLDSSYHSSCCQS
AANSSSQSTSPSSSSPNTPTGSSGSNHGGNAGSVAVAPSALSVQLPSAPPPTQLVLLPHVGAVVGSNPTSVGNVPVSPTG
VVPQLYQRPSTLHGLKHKLHAATAVIAGGGNANNPAGGLKTLHTTNNNSLPNRRKSVGHIPLSPLARTPSPSPLPSSPTR
SPSPLAFPLVGHQPGASNTTQSYSPGSTLPTLQTAVNANTKKAGFARTKSAEPSSPLLRRALSPDRLHPRSAETKISPLC
CSPPIKQPTHQRVVTTTWRSTPGGSASGAGGAVLGAPSVQPLQLVPAASEESQRQTAMATVVSTTAAGTDPSATAVVTLA
NCEPLPRIAEEKDSPTSTQDSSSVSEGFMPAIEEFAEGESSSSPTQTLEKPTKVKATEQPEMEPAGKSKKVDQGKTTTPG
TPKTKPHNSGCKTSMTTTKPASPSVTISTAPRKDTSAVTGGGSSGSGGSAATSAAKQRK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0075562
7222
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0332091
7868
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0304401
2139
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG6498-PA
dop-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)