Open Close
General Information
Symbol
Dmel\Apt1-PB
Species
D. melanogaster
Annotation Symbol
CG18815-PB
FlyBase ID
FBpp0075835
Associated gene
Length (aa)
216
Theoretical pI
6.23
Predicted MW (kDa)
23.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MAAPVIVEATVKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGFRMPSWFDLKTLDIGGPEDEP
GIQSARDSVHGMIQKEISAGIPANRIVLGGFSQGGALALYSALTYDQPLAGVVALSCWLPLHKQFPGAKVNSDDVPIFQA
HGDYDPVVPYKFGQLSASLLKSFMKNVTFKTYSGLSHSSSDDEMDDVKDIISKWVN
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0076104
1237
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0076103
1247
FBtr0076105
1181
FBtr0331544
1373
FBtr0331545
1136
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0075834
216
FBpp0075836
216
FBpp0303934
221
FBpp0303935
232
External Crossreferences and Linkouts ( 4 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
Apt1-PB
CG18815-PB
Name Synonyms
Secondary FlyBase IDs
    References (2)