Open Close
General Information
Symbol
Dmel\Ae2-PE
Species
D. melanogaster
Annotation Symbol
CG8177-PE
FlyBase ID
FBpp0076052
Associated gene
Length (aa)
1228
Theoretical pI
7.00
Predicted MW (kDa)
138.4
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MDKVFAGNSARKDKFDVNTFQDNSQLPIGSRKKNSIRTNDLNIEEDSEYESQTEPLNNAQNYDDIPEDFPLVSERAGHGD
HSDNSVDEKHVQFGGKKKIPPSLSYDEQPTDQSHERKRRRSRHQYYRQRKFSHQDSVEPKNKLEENGDAGARRISVQPED
TALEEADLNELRSHRSDDPRALRRHKIHHSSIKLRELPQITISPFTNKKPEVDHSPHEIFVQLDELTGVGEDREWKETAR
WIKYEEDVEEGSDRWGKPHVASLSFHSLLNLRRCLETGVVLLDLNEKDLPAVAYRVVEQMVIEDLIDINDKPSVMRSLLL
RHRHVNEHQGVLPFTKRKYNSYTSLQFLWMGADSAHQPYQQAQPPPRNLAKARRSICVTSSAPPTAAMLNVATATAAAAA
IDHRRHSTMSYLGNLSGTDDKKIKIMPAAEIGGSKRSNELKIDMKDDMYSSSQEDLKKLQNDTILKRIPAGAEATTVLVG
AVEFLEQPTIAFVRLSEGVLMPTLTEVPVPVRFMFVLLGPRNFDLDYHEVGRSISTLMANEHFHSIAYKADDRKDLLSAI
NEFLDDSIVLPPGNWDRHDLLPFEELKAKKDWIRTRKIKALQVKRDSEMIKIGKDEEKALLEKQTLGAIGFTIGGGDGGG
DGDSDDDNGRKKKKPSPLEKTGRLWGGLRNDLKRRMPMYKSDILDGLNTETLAATIFMYFACLSTAITFGGLVSAKTNSW
IGISETLISCSLVGIVFHCLSCQPLVIIGTTGPLLLFDEALMVFCTQHEFDFLSLRVYVGVWLIIIALTVSAFEGSVYVR
LLTRFTQEIFSALITLIYIVETFMKLISIYRENPLLSDYNLPPPTLVAHEHATNESLLNATASVTTNITQMVMNISTTAM
PIGPPPLPKNQPNTALFCTILTLATFVVAYYLKLFRNSHFLGRNARRALGDFGVPISIAIFVLVDYLVPAVYTEKLVVPE
GLSPSDPSKRGWYIGFDTSSTWIPFACVIPALLVYILIFMESQISELIVDKPDRGLKKGSGLHWDIVLLCLLNCACGIFG
MPWHCAATVRSVTHVSSVTIMSRTHAPGESPRIVDVKEQRLSGFFVCLMIGLSVLMAPLLRLIPMAVLFGVFLYMGVASM
SGVQLFERIRLYFMPVKHYPPTSYVKRLRPWKLHLFTTIQVLCLVLLWSVKSSQFSLAFPFFLIMMVPIRQNLTKLYKPE
EMQALDGSEMKKNDDDEPDFYEQTNIPA
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0076323
5099
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0076321
5144
FBtr0076320
5173
FBtr0076317
5319
FBtr0076322
4668
FBtr0076318
4515
FBtr0076319
5759
FBtr0076324
4869
FBtr0076325
5043
FBtr0076326
4994
FBtr0076327
4965
FBtr0301228
1450
FBtr0331848
5620
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0076050
1268
FBpp0076049
1201
FBpp0076046
1201
FBpp0076051
1161
FBpp0076047
1201
FBpp0076048
1268
FBpp0076053
1201
FBpp0076054
1201
FBpp0076055
1166
FBpp0076056
1233
FBpp0290446
371
FBpp0304232
1210
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
Ae2-PE
CG8177-PE
Name Synonyms
Secondary FlyBase IDs
    References (2)