Open Close
General Information
Symbol
Dmel\CG8336-PB
Species
D. melanogaster
Annotation Symbol
CG8336-PB
FlyBase ID
FBpp0076113
Associated gene
Length (aa)
383
Theoretical pI
7.77
Predicted MW (kDa)
43.1
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MEERKLLRAVKSTNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVFVV
QSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNGTNVVVGRVLRGLGIVAE
MEQNCTDEGDPTAPIVIRDCGEIAHNEDWGIECNDETTDKLPAYPQDWPRKLDKFTGDGAVELLTGIRQSGNHFYQLGRY
HEARAKYRKANRYYHYLSRQFGWQQLNPLKKHLVDEDLLKVDGFSVVNNINAAAVDLKVGNYTSAREVCNEAIRLDPKCS
KAFYRRAQAQRGLRNYEEAINDLKTAHNLLPENKQILNELNSTKQLLAQYNRQQRNALKNLFA
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0076384
1555
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0076385
1500
FBtr0076386
1445
FBtr0333855
1395
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0076114
383
FBpp0076115
383
FBpp0305988
383
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG8336-PB
Name Synonyms
Secondary FlyBase IDs
    References (2)