Open Close
General Information
Symbol
Dmel\nmo-PF
Species
D. melanogaster
Annotation Symbol
CG7892-PF
FlyBase ID
FBpp0076475
Associated gene
Length (aa)
430
Theoretical pI
7.61
Predicted MW (kDa)
48.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSVSMSLVQGGAAGGAPQGASAILAAAAPYYQPPAVPQDVQPDRPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVS
SKRVFRELKMLCFFKHENVLSALDILQPPHLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSA
RILHRDIKPGNLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGRR
ILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPPSFSVLYTLSSHATHEAVHLLCQMLVFDPDKRISV
TDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTADFEPSAGQPFDDLWERKLTSVQQVKEEMHKFIAEQLQTGRVPLC
INPQSAAFKSFASSTVAHPSELPPSPHQWE
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0076758
2757
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0076754
5131
FBtr0076755
3131
FBtr0076757
2624
FBtr0076756
2421
FBtr0076759
2250
FBtr0333223
6235
FBtr0474156
2250
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0076471
414
FBpp0076472
414
FBpp0076474
414
FBpp0076473
430
FBpp0076476
430
FBpp0305425
430
FBpp0423155
439
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG7892-PF
Name Synonyms
Secondary FlyBase IDs
    References (2)