Polypeptide Dmel\Pdp1-PF

General Information
Symbol	Dmel\Pdp1-PF	Species	D. melanogaster
Annotation Symbol	CG17888-PF	FlyBase ID	FBpp0076490
Associated gene	Dmel\Pdp1

Length (aa)	250	Theoretical pI	6.80
Predicted MW (kDa)	28.3

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MSEPKENIMDLSVRGKSTSNSKEIICPDDKYKEEGDIWNVEAQTAFLGPN LWDKTLPYDADLKVTQYADLDEFLSENNIPDGLPGTHLGHSSGLGHRSDS LGHAAGLSLGLGHITTKRERSPSPSDCISPDTLNPPSPAESTFSFASSGR DFDPRTRAFSDEELKPQPMIKKSRKQFVPDELKDDKYWARRRKNNIAAKR SRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLRARLSKFQDV
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) Pdp1-RF FBtr0076775 2828
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) Pdp1-RB FBtr0076776 5065 Pdp1-RC FBtr0076782 4746 Pdp1-RD FBtr0076780 4702 Pdp1-RG FBtr0076777 5107 Pdp1-RI FBtr0300499 3862 Pdp1-RJ FBtr0300500 4643 Pdp1-RK FBtr0306535 6398 Pdp1-RL FBtr0332080 4197 Pdp1-RM FBtr0332081 5080 Pdp1-RN FBtr0332082 5098 Pdp1-RO FBtr0332083 2870
Other Polypeptides
	Name FlyBase ID Length (aa) Pdp1-PB FBpp0076491 270 Pdp1-PC FBpp0076497 570 Pdp1-PD FBpp0076495 647 Pdp1-PG FBpp0076492 284 Pdp1-PI FBpp0289726 232 Pdp1-PJ FBpp0289727 633 Pdp1-PK FBpp0297493 270 Pdp1-PL FBpp0304390 581 Pdp1-PM FBpp0304391 275 Pdp1-PN FBpp0304392 281 Pdp1-PO FBpp0304393 264
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_729297 DDBJ / EMBL / GenBank • AAN12021
Synonyms
	CG17888-PF Pdp1-PF
References ( 2 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453] FlyBase, 1996-, FlyBase inference based on genome sequence analysis. FlyBase inference based on genome sequence analysis. [FBrf0104946]