Open Close
General Information
Symbol
Dmel\axed-PD
Species
D. melanogaster
Annotation Symbol
CG8398-PD
FlyBase ID
FBpp0076690
Associated gene
Length (aa)
435
Theoretical pI
7.35
Predicted MW (kDa)
49.3
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MVLPFGLGPDGHHVDAIQSAPAPSAPPAHMMPPAYARGQTNIYTGVPIIVNPYIDFIVVNGDDRYMIRCERKSVLERSVE
LAKLIHAGPNSGRKSDNHFQILNVDKNDFELIVRYMEKHFIPYRDHKHLLKILELSDRFNVPDLIIYCIRELDLRISSAT
ALDIFKALWFYQGIALTNQHQTVITTQETGQQLARKKATKAKAAAKQLAAAKASQSTENGAEGDGAQQNLIPNPNPFTTE
DYGVALLHNTLQLIDMHAELQLSMPEISDLRFEELETLVKRDTLQLRSEVTLFECLATWSLAECARKHIDATPENRRTVL
GPLCLTPRYLRMTASEFRRCCERLELLPPTEISLITDALDGKKLKNLTDQQAELLEKFRQPRAEYARMPVHLSDRSSPKN
YPKKMRLAHEGRPTEDGCWEKVGMNCLRIFVCIFD
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0076981
2094
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0076978
2878
FBtr0076980
1850
FBtr0330184
1911
FBtr0474136
2878
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0076687
537
FBpp0076689
435
FBpp0303217
435
FBpp0423135
582
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG8398-PD
axed-PD
Name Synonyms
Secondary FlyBase IDs
    References (2)