Polypeptide Dmel\DIP1-PC

General Information
Symbol	Dmel\DIP1-PC	Species	D. melanogaster
Annotation Symbol	CG17686-PC	FlyBase ID	FBpp0077064
Associated gene	Dmel\DIP1

Length (aa)	395	Theoretical pI	8.42
Predicted MW (kDa)	43.0

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MKRNRRAFAGNNKPFVFGGIYAANVQEQQSSPVALYPTSASPVAVQSPQD AFLAVQSPGAPAPVQLANSSDQQNNPDADAIASKLPMPVIIKEEPISVND EPSVDNIEDNTSASTSASGIGGKIPFKKIFQKRKKSSERTRDKKLRQNRQ LRKSMLPKNALMALNEVKGVTISDFTIDSNTDGGFTAVVTVNSNQYEGKG TSKMTAKNAACEKAWRDFIIAKMTPKPPRIHQVEMGSEPMDINEDEADAP DDDLPMLNLASFAIYKLFAEWEREGYVVPEMHPSANAAQQAGGDAGTPVP PVPKEPKKPPVRTELPSGWETMHPATILCIMRPGLNYVDYGSSGDKTNGM QHLGIMVDNQEFHANGRSKKIARRNVAVKVCNSLFGTNFTYSDTT
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) DIP1-RC FBtr0077372 2569
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) DIP1-RB FBtr0077371 3563 DIP1-RD FBtr0077373 2614 DIP1-RE FBtr0300373 3833 DIP1-RF FBtr0300374 3518 DIP1-RG FBtr0301292 3205 DIP1-RH FBtr0301293 2476 DIP1-RI FBtr0301294 3487
Other Polypeptides
	Name FlyBase ID Length (aa) DIP1-PB FBpp0077063 409 DIP1-PD FBpp0077065 410 DIP1-PE FBpp0289602 378 DIP1-PF FBpp0289603 394 DIP1-PG FBpp0290507 378 DIP1-PH FBpp0290508 309 DIP1-PI FBpp0290509 378
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_524668 DDBJ / EMBL / GenBank • AAN09006
Synonyms
	CG17686-PC DIP1-PC
References ( 2 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453] FlyBase, 1996-, FlyBase inference based on genome sequence analysis. FlyBase inference based on genome sequence analysis. [FBrf0104946]