Open Close
General Information
Symbol
Dmel\bowl-PD
Species
D. melanogaster
Annotation Symbol
CG10021-PD
FlyBase ID
FBpp0077181
Associated gene
Length (aa)
744
Theoretical pI
7.20
Predicted MW (kDa)
79.8
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MPTESSSSEISGGGGGAIPMLRPSRMDQFMNSMAAAAAAVGGGGLPGAADRNGGSGGSDGGSQNGNGDSRNSSASRISAY
ETQLAYQQHLAGLHGPPPPPPPSHHREISAFVPVLPTGKVRPGSNSNYEIIAMMADKRKELALREAAAAAAMLGRGPGGP
GGPGVPPPGVLYGPAGVPPPPYLTGPGPSPTGAGSFPFPPGAAAAALFPPGLGPGMHAGLDRRLLRAPGRASRPKKQFIC
KFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYIHSKEKPFKCTECGKGFCQSRTLAVHKILHMEES
PHKCPVCSRSFNQRSNLKTHLLTHTDHKPYECSSCGKVFRRNCDLRRHALTHAVGEVNSGDYVDVGEEDEARNLSGDEED
SLLEVDSPRQSPVHNLGESGGSGEKSESERMRLKRKAAIDHEESEEEFDDFDEEEELQDLPRVHDLPREEDDDFDPEDEE
QAEVALVARFQASKAAATSQSSSSVGTKPERQGVTHCHHEGGETYTMRPHGEKHQEEPGNSGIASLPVPPSFVRYSVPPG
AAGPPPAPPGAPPPTHQHPGHPHLLPPNGDPYLPILHVRRDLHHKSLNLSKAGVPPPPHTPPTIITQPESGKPPNQPLHS
PHEAMPSFLGSIPMRKRILPAPTLDLMDPHHHPGLGQRTFVDSPSIYALNMSRHPPRQLLGKPPSTETSGATTEKGPPVA
APPIAPPPAPPRRTGFSIEDIMRR
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0077492
3630
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0077493
3485
FBtr0077490
3513
FBtr0077491
3424
FBtr0307027
3507
FBtr0307028
3394
FBtr0307029
3435
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0077182
744
FBpp0077179
744
FBpp0077180
744
FBpp0297870
744
FBpp0297871
744
FBpp0297872
744
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG10021-PD
Name Synonyms
Secondary FlyBase IDs
    References (2)