Open Close
General Information
Symbol
Dmel\chinmo-PD
Species
D. melanogaster
Annotation Symbol
CG31666-PD
FlyBase ID
FBpp0077545
Associated gene
Length (aa)
604
Theoretical pI
7.93
Predicted MW (kDa)
62.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MDPQQQFCLKWNSFSSNLAITFSNLFKSDLLADVILSCDGVVFKAHKLILAACSKKFADLFENTPTNGQCVIILEATTPD
NMAALLEFMYKGEVHVSQEALNSFLKSAESLQVKGLSTETGRLAAQQAQQHMGDLSPLDSPTGRRSVRNSLSGGSSSIVP
GGVGIGLGGGATGANSMSGMGIGNGLSLAGMAAGGGMAAAANAAASSLSTLAASANIVDRCGSAGANIISGSAAGIGGSH
SGGAGNGSGTVGIGGNGVGSGGGNNGPISLGSGAGAAHHLGGSTGILKQECDSLMHPGGSSSSSGMGYTHVPPIYRPINY
EPPRKRAIVRSPYSEQEQRGSVLRDGSKSSECPSPINKPPYHRPSSSASSTAPTEADTMHSERASPQSSRYENHSPSTTA
GNGNATSSLERIVKSERNNGSANEANDDDRELMDESTDNGAEDLRVKLENLKYSPPPPPNSNTSSTTPNTLLENLKADGT
LSSNLAASIAPADMLNVWNATKMNNKNSVNTADGKKLKCLYCDRLYGYETNLRAHIRQRHQGIRVPCPFCERTFTRNNTV
RRHIAREHKQEIGLAAGATIAPAHLAAAAAASAAATAAASNHSP
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0077877
6019
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0077878
4159
FBtr0303933
6320
FBtr0303934
5037
FBtr0303935
6089
FBtr0307047
12385
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0077546
604
FBpp0292932
840
FBpp0292933
840
FBpp0292934
604
FBpp0297890
604
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG31666-PD
chinmo-PD
Name Synonyms
Secondary FlyBase IDs
    References (2)