Open Close
General Information
Symbol
Dmel\Pitslre-PA
Species
D. melanogaster
Annotation Symbol
CG4268-PA
FlyBase ID
FBpp0077905
Associated gene
Length (aa)
952
Theoretical pI
8.20
Predicted MW (kDa)
108.8
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MVNSSGSEDGQLRSPNDVHYHSRGEEDEHEGDADALYIQPPQASRESGSGPRREKKKHSRERRRHKERDDVGGAALALER
DHRYDYRSREEHYHHHQRERSSNAAAAYAKHHLGHAYHYPQPPQQQQQPLPPAPSYAAHHYHHHQHLSGARAAPREYHSY
PSGYHSGSRHGDYPMEEPTRRSSKYAESKDAESLEQDLRSRLLKKRHNYVKDYETEENYEHRVERSDRREGGRKERERTV
RSTHKQNRHDRVIELLDSPEQEHHHQHQHKSHRSKWREEVEVIRRKVPEDLELLARREKLLAAERESRQRKQTAREELEA
RRELLRERNEHSDALSPTTVAASVTAGLNIHVKRKSKPDNYEKEIKLKKRREDDIEVIRDDDDEESEESDSNEEVPEQDS
EGSATESGSEDSYASKKKSKIKSKSQLEDDDEDLPLPDSPLSVGELYKSPKQRQRSRSVSSKSSSQSSRSSRSRSRSRSQ
SSLEDEVDRQDVGADASPSSSTRSEERGMTQEQPEEKPEEKLKEKQKSLEEQIPCDDKGIPLPNYYPGVQGCRSVEEFQC
LNRIEEGTYGVVYRAKDKRTNEIVALKRLKMEKEKEGFPITSLREINTLLKGQHPNIVTVREIVVGSNMDKIFIVMDYVE
HDLKSLMETMKNRKQSFFPGEVKCLTQQLLRAVAHLHDNWILHRDLKTSNLLLSHKGILKVGDFGLAREYGSPIKKYTSL
VVTLWYRAPELLLCSPVYSTPIDVWSVGCIFAEFLQMLPLFPGKSEIDELNRIFKELGTPNEKIWPGYTELPAVKNMLSQ
NSQFTEYPVSQLRKHFQEKTSEMGLSLLQGLLTYDPKQRLSADAALKHGFFKELPLPIDPSMFPTWPAKSELGARKAQAS
SPKPPSGGSQFKQLGRDEPIIVGPGNKLSSGIITGNKKSHGAGGSSASTGFVLNAGITQRQLAMGPGFSLKF
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0078247
3355
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0078250
3296
FBtr0304935
4391
FBtr0304936
3620
FBtr0331523
3939
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0077908
952
FBpp0293474
778
FBpp0293475
778
FBpp0303913
778
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG4268-PA
Pitslre-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)