Open Close
General Information
Symbol
Dmel\SPoCk-PB
Species
D. melanogaster
Annotation Symbol
CG32451-PB
FlyBase ID
FBpp0078185
Associated gene
Length (aa)
1034
Theoretical pI
5.67
Predicted MW (kDa)
113.8
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MKNHNKYVKLPQDLDLSFHSDLDLLPDTAADIDVELDPAADTDVAALSVNVPASLGLDEDDDDEVIIAPGGGGLRLAPTA
AEAVAAHRQHHQQHQQCKQLKNQLEQKQILPKSKICGLGSDSIVETGLTLTPEMLLSTSESSTHSASEVAGRLQVDVRTG
LKWTEAKYRAKIIGHNELLLVAEDPTWKKYIEQFRNPLILLLLGSALVSVIMKQFDDAVSITIAILIVVTVAFIQEYRSE
KSLEELKKLVPPECHCLREGRLDTFLARELVPGDIVHLNVGDRVPADVRLFEAVDLSIDESSFTGETEPARKITDVLLNN
TNVKDHSNMKNIAFMGTLVRCGNGKGIVVSTGERSEFGEVFKMMQAEEAPKTPLQKSMDILGAQLSFYSFLIIGVIMLLG
WLQGKPLSEMFNISVSLAVAAIPEGLPIVVTVTLALGVMRMAKRNSIVKKLPTVETLGCVNVICSDKTGTLTKNEMTATI
IITSDGYMADVTGAGYNDQGEIHIRHCNNVEMAKTNITNLLEIGAVCNNAYIQNGTLLGQPTEGALVAVAMKNGMYATAE
NYVRIQEYPFSSEQKMMAVKCIHKYNNNKEEIFFAKGALETLLPQCTKYQFGTQTVPLTKQNEAEFLAEAYEIGRKGLRV
LALAKGRSMQDLIYCGLVGITDPPRPLVRESIEMLMQSGVRVKMVTGDAQETALAIANLIGIDTIHHQTLSGQEMDQMNE
HQLDKVANNVSVFYRVSPRHKLEIVKSLQRSGNIVGMTGDGVNDGVALKKADIGIAMGKNGTDVCKEAADMILVNDDFHT
IIAAIEEGKGIFYNIRNFVRFQLSTSIAALALIALATLMDIANPLNAMQILWINIIMDGPPAQSLGVEPVDHDVLKQKPR
NVKQPMITKSVVVNVLLSASIIVLGTLWVFQREMADGTLGKTKRDTTMTFTCFVFFDMFNALSCRSQTKSVFTIGLTTNR
MFLLAVAFSIIGQMLVVYFPPLQMVFQTEALTPYDIFFLVSLTSSVLVVSEIKKWFERTMERKMYSTRSELDFV
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0078533
5916
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0078531
3659
FBtr0078532
3716
FBtr0113437
3742
FBtr0302134
4245
FBtr0306600
4059
FBtr0332105
3937
FBtr0474170
3659
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0078183
901
FBpp0078184
924
FBpp0112349
997
FBpp0291344
917
FBpp0297555
917
FBpp0304415
1062
FBpp0423169
916
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG32451-PB
SPoCk-PB
Name Synonyms
Secondary FlyBase IDs
    References (1)