Open Close
General Information
Symbol
Dmel\CG1213-PC
Species
D. melanogaster
Annotation Symbol
CG1213-PC
FlyBase ID
FBpp0078293
Associated gene
Length (aa)
491
Theoretical pI
5.49
Predicted MW (kDa)
53.3
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MPSISREEETGVQYSYTEVSTFQIREGNTRTMSPEPVKSGRIFMAAVAANLSAFVVGTTLGWTSPIGPKLKSEDTSDSPL
SRPITSDEDAWISSLIAVGALVAPFVAGPMADRIGRKWVLLSSSLFFVLAFGLNMVASEVWILYMSRLIQGFGVGFVMTV
QPMYVGEISTDNVRGATGSLMQLFIVGGILYVYAIGPYVSYQALQWCCIVVPVVFDLVFYMMPESPYFFAGKGRKSEALK
SLQFLRGQSAEGVHDEMAEIQANVEEAMASKGTVMDLFKNAGNRRALFICAGLISFQQLSGINVVLFNSQSIFASANTGL
DPAIATIIIGCVQVGSSALTPLVADRLGRKVMLLTSSSVMSIGLAALGAFFYMQLVKGDISSVVWMPVPALIIYNIVYCT
GFGPLPWAVLGEMFPANIKSVASSVVASTCWTLGFLVTFFYPSLDALGSYYAFWLFAVCMVVAFFFVLFVVMETKGLSLQ
QIQDRLNGKRN
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0078644
2092
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0078643
1761
FBtr0078642
1862
FBtr0305954
1862
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0078292
491
FBpp0078291
491
FBpp0297096
491
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG1213-PC
Name Synonyms
Secondary FlyBase IDs
    References (2)