Polypeptide Dmel\MED31-PB

General Information
Symbol	Dmel\MED31-PB	Species	D. melanogaster
Annotation Symbol	CG1057-PB	FlyBase ID	FBpp0078497
Associated gene	Dmel\MED31

Length (aa)	204	Theoretical pI	7.91
Predicted MW (kDa)	23.5

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MAKMYGKGKTAIESEELQKRRWQIELEFVQCLSNPNYLNFLAQRGFFKDQ SFINYLKYLQYWKEPDYAKYLMYPMCLYFLDLLQYEHFRREIVNSQCCKF IDDQAILQWQHYTRKRIKLIENVTAAQQQQQQLQQQQQQANGMEAATGGE SAAPTPNVNGSASTADSQQTSSALQPVQAQPGNPQQQQQINGVASGANIK LELN
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) MED31-RB FBtr0078857 823
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) MED31-RA FBtr0078856 1098 MED31-RC FBtr0305312 818 MED31-RD FBtr0336456 1092
Other Polypeptides
	Name FlyBase ID Length (aa) MED31-PA FBpp0078496 204 MED31-PC FBpp0293855 204 MED31-PD FBpp0307562 202
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_730861 DDBJ / EMBL / GenBank • AAN13286
Synonyms
	CG1057-PB MED31-PB
References ( 1 )
FlyBase analysis	FlyBase, 1996-, FlyBase inference based on genome sequence analysis. FlyBase inference based on genome sequence analysis. [FBrf0104946]