Polypeptide Dmel\CG9766-PA

General Information
Symbol	Dmel\CG9766-PA	Species	D. melanogaster
Annotation Symbol	CG9766-PA	FlyBase ID	FBpp0078619
Associated gene	Dmel\CG9766

Length (aa)	197	Theoretical pI	7.10
Predicted MW (kDa)	21.4

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MLRRRPSLMEYPASNGFLPLANAIIQGEMCIIDLLLSAGCSVHIGDPGSG RTPLHLAFYYGHLPSARILLNKKARLEATDSNGMTPAHCAVDANQLEIVK FALEAGANAEARDVCGWTLLMRAVVMNASMELIKVLVTHGADLAALDGVG KTCTDLAKLYHRQEAKDYFDEVQKFRLEKSVATADAVTAITRYTKEV
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) CG9766-RA FBtr0078980 1075
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) CG9766-RB FBtr0078979 1184 CG9766-RC FBtr0113191 1367
Other Polypeptides
	Name FlyBase ID Length (aa) CG9766-PB FBpp0078618 279 CG9766-PC FBpp0112103 340
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_649448 DDBJ / EMBL / GenBank • AAF52154
Synonyms
	CG9766-PA
References ( 2 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453] FlyBase, 1996-, FlyBase inference based on genome sequence analysis. FlyBase inference based on genome sequence analysis. [FBrf0104946]