Open Close
General Information
Symbol
Dmel\eIF4A-PA
Species
D. melanogaster
Annotation Symbol
CG9075-PA
FlyBase ID
FBpp0078806
Associated gene
Length (aa)
403
Theoretical pI
5.34
Predicted MW (kDa)
45.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MDDRNEIPQDGPASMEPEGVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGK
TATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTPGRVY
DMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTL
EGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSS
RVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANIA
DLI
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0079175
1691
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0079177
1847
FBtr0079176
1553
FBtr0079178
1960
FBtr0307068
2021
FBtr0331201
1939
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0078808
403
FBpp0078807
403
FBpp0078809
403
FBpp0297911
403
FBpp0303628
403
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (3)
Reported As
Symbol Synonym
CG9075-PA
eIF-4a-PA
eIF4A-PA
Name Synonyms
Secondary FlyBase IDs
    References (1)