Open Close
General Information
Symbol
Dmel\CG18304-PA
Species
D. melanogaster
Annotation Symbol
CG18304-PA
FlyBase ID
FBpp0078995
Associated gene
Length (aa)
1895
Theoretical pI
9.94
Predicted MW (kDa)
212.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MHHLYPSLKGDQLCPLGFHPQTRYPTRCKRCFRDYKEHGARRAGEEVAASSPNLSDAQSSRPSSRTWTSTQNLTSANATN
GNDIELRKRPQSWASTPDIDEPDNVARRPPATASTSRAASSAEDQDVAVTVKLPVPPRRHTTALDIKEVEHAITPPTRVT
SSPSKTSSIPDELVILSTDSLAERVRKMNLLKKQRSLNSRENSRERSVPRREEESESTATPTPVVPDRPERSKSGTSLNQ
LAQAEQKRAALPPKKVAVASTTTASSSNSSSTSLKTSNSTSASNEVKVVTSTSSSSTSSSSVRRKEADSVASKEIKRQTV
PAASISHSNSTSSTASTASKSQDTNGMQEQMKALKLELETMKTRAEKAEREKSDILLRRLASMDTASNRTAASEALNLQQ
KLNEMKEQLDRVTEDKRKLNLRMKELENKGSESELRRKLQAAEQICEELMEENQSAKKEILNLQAEMDEVQDTFRDDEVK
AKTSLQKDLEKATKNCRILSFKLKKSDRKIETLEQERQSSFNAELSNKIKKLEEELRFSNELTRKLQAEAEELRNPGKKK
APMLGVLGKSTSADAKFTRESLTRGGSQEDPQHLQRELQDSIERETDLKDQLKFAEEELQRLRDRERKRVRFSCGTQTEV
PLEVVAFPRGTQTVATVQSDMSTSVENLVTSNVAVTQTDFEVPDRNVSIERETMSSPFAGLFPPSSSSRVGQSGSLLFPS
AISHVLLSGAGRKLSPTPHPHRLAPEVHADRDEGISDEDDPAELRILLELNEQEASILRLKVEDLEKENAESKKYVRELQ
AKLRQDSSNGSKSSLLSLGTSSSAAEKKVKTLNEELVQLRRTLTEKEQTVDSLKNQLSKLDTLETENDKLAKENKRLLAL
RKASEKTGEVDQKMKESLAQAQRERDELTARLKRMQLEAEDKLPPRTAKRVNDLTPKSHLKKWVEELEDEISEMRVMLSS
SGTDQLKALQSAKGALEEDLRKCKQKLSLAEGDVQRLKLLNGSSSKVSELEQKLKRGDEEAKKLNSKLKDLEDKVKKQEA
QLKLGETSKSTWESQSKREKEKLSSLEKDMEKQAKEKEKLEAKISQLDAELLSAKKSAEKSKSSLEKEIKDLKTKASKSD
SKQVQDLKKQVEEVQASLSAEQKRYEDLNNHWEKLSEETILMRAQLTTEKQSLQAELNASKQKIAEMDTIRIERTDMARK
LSEAQKRIADLQAKALKTVNGNGAEYERTVLKNKLAEKEHEYERLRRENEMNIDLVFQLRKDNDDLNGKLSDYNRIEQAQ
SSLNGHGARREAEIRELKEQLQSTELQMKSEVATVRLRYEQQVKNLSGELTSMQRQCERFKKDRDAFKQMLEVAQKKIGD
LKANNTGRQSRGSMHSSDDDDKSKIAYLEQQIGHLEDQLVESRLESSKIKTELVSERSANEIKISEMQSKLNEFEEERVI
GSGSTKLPGMKTKLELSWQKEREDQQRLLQETSTLARDLRQTLFEVERERDKERLESKRKLDQIKRATEEEMEEGRKKIA
ELQCDLLELRDVHAKLRTSNEKLRRERERYEKELIKRRMEADGGDRKVGALLQTVDELVKIAPDLKIVGSGGSARSSSSS
GYDKNLRPEQPNVRRSRSPSPTLSSSQITSVLARLAEASEELRKFQRVNEDEQERSRMRRSNLRRAASQENDPHGSTSSV
ASAAGSQRGGGRLSRNSSNNGSLIRKSLSLDHSIQRDQNIWRQDDGSVSSMQSIDSELGGLVRDSSLDSRLDSRLSGGST
QSDIPRGPRKKKKGIMGKLRSLTKSSRNSESEISIQGSDSDISVASDMRSSKKDLRGRLSGMFKRSGSASRSESMERAGS
DQRPVAVTVVGHPDGPQPREPPPANSLTPRPIRSIPKPPSAGAPTTPTTRRRVAK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0079367
6532
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0306285
6304
FBtr0332326
6286
FBtr0332327
6550
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0297395
1819
FBpp0304604
1813
FBpp0304605
1901
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG18304-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)