Polypeptide Dmel\nrv2-PC

General Information
Symbol	Dmel\nrv2-PC	Species	D. melanogaster
Annotation Symbol	CG9261-PC	FlyBase ID	FBpp0079009
Associated gene	Dmel\nrv2

Length (aa)	323	Theoretical pI	7.39
Predicted MW (kDa)	37.3

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MPTITEDCIDGFQQYYSRPPERPKKKSLKQMVYDSEDNSYFGRSMDSWAK IGIFYVAFYGVLAALVAICMWAFFQTLDPRIPKWTLDRSLIGTNPGLGFR PLPPVDNVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNI YNCDYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGW IPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQE NIGAVNYLPIRGFPGYFYPYQNSEGYLSPLVAVHFQRPKRGIIINVECRA WARNIIHDRKERIGSVHYELLID
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) nrv2-RC FBtr0079381 2668
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) nrv2-RA FBtr0079382 1980 nrv2-RD FBtr0079383 2156 nrv2-RE FBtr0100381 1949 nrv2-RF FBtr0100382 2143 nrv2-RG FBtr0332369 2635
Other Polypeptides
	Name FlyBase ID Length (aa) nrv2-PA FBpp0079010 322 nrv2-PD FBpp0079011 322 nrv2-PE FBpp0099793 322 nrv2-PF FBpp0099794 323 nrv2-PG FBpp0304645 323
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_477168 DDBJ / EMBL / GenBank • AAN10600
Synonyms
	CG9261-PC nrv2-PC
References ( 3 )
FlyBase analysis	FlyBase Genome Annotators, 2005, Changes affecting gene model number or type in release 4.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 4.2 of the annotated D.melanogaster genome. [FBrf0182792] FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453] FlyBase, 1996-, FlyBase inference based on genome sequence analysis. FlyBase inference based on genome sequence analysis. [FBrf0104946]