Open Close
General Information
Symbol
Dmel\CG7115-PA
Species
D. melanogaster
Annotation Symbol
CG7115-PA
FlyBase ID
FBpp0079146
Associated gene
Length (aa)
524
Theoretical pI
9.23
Predicted MW (kDa)
58.0
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MDDELEDKVFYQTYVSHMKILSKFAVGFSSINSPLAYIWKLCRLYVLRPEVIFCGLILFVLLLYLQAVDVWSRSILGRIQ
ATLGRQKAVKMMELSASAGDHQSWEEMKQQSSAFAVLGRRPRMEDRFIIEENINNNTGISFFAVFDGHGGEFAADFAKDV
LVKNIYNKIIEMSKLLKTEGNSGDYDKSPYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIKQKTTEASIA
DIYTVQLNSAMRASGNLGAAKDSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRINFGKLITDEIMSADYKLVEQAKRATN
IAGTTALIAIVQGSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERKRIHDAGGFIAFRGVWRVAGVLATSRALGD
YPLKDKNLVIATPDILTFELNDHKPHFLILASDGLWDTFSNEEACTFALEHLKEPDFGAKSLAMESYKRGSVDNITVLVI
VFKNDVYKIGSSAGKAGEESLKVPAKSQPVAPAVVQRSNSIKTK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0079523
2646
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0079524
2238
FBtr0331234
1995
FBtr0331235
2001
FBtr0331236
2612
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0079147
524
FBpp0303676
469
FBpp0303677
471
FBpp0303678
524
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG7115-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)