Polypeptide Dmel\dUTPase-PA

General Information
Symbol	Dmel\dUTPase-PA	Species	D. melanogaster
Annotation Symbol	CG4584-PA	FlyBase ID	FBpp0079746
Associated gene	Dmel\dUTPase

Length (aa)	188	Theoretical pI	5.08
Predicted MW (kDa)	20.0

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MPSTDFADIPAAKKMKIDTCVLRFAKLTENALEPVRGSAKAAGVDLRSAY DVVVPARGKAIVKTDLQVQVPEGSYGRVAPRSGLAVKNFIDVGAGVVDED YRGNLGVVLFNHSDVDFEVKHGDRIAQFICERIFYPQLVMVDKLEDTERG EAGFGSTGVKDLPAAKAQNGNGEKAAEPEGAAPAPVAT
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) dUTPase-RA FBtr0080157 824
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) dUTPase-RB FBtr0080156 751 dUTPase-RC FBtr0331195 771 dUTPase-RD FBtr0331196 769
Other Polypeptides
	Name FlyBase ID Length (aa) dUTPase-PB FBpp0079745 174 dUTPase-PC FBpp0303622 174 dUTPase-PD FBpp0303623 174
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_609479 DDBJ / EMBL / GenBank • AAF53053
Synonyms
	CG4584-PA dUTPase-PA
References ( 1 )
FlyBase analysis	FlyBase, 1996-, FlyBase inference based on genome sequence analysis. FlyBase inference based on genome sequence analysis. [FBrf0104946]