Open Close
General Information
Symbol
Dmel\loqs-PA
Species
D. melanogaster
Annotation Symbol
CG6866-PA
FlyBase ID
FBpp0080075
Associated gene
Length (aa)
419
Theoretical pI
8.36
Predicted MW (kDa)
44.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MDQENFHGSSLPQQLQNLHIQPQQASPNPVQTGFAPRRHYNNLVGLGNGNAVSGSPVKGAPLGQRHVKLKKEKISAQVAQ
LSQPGQLQLSDVGDPALAGGSGLQGGVGLMGVILPSDEALKFVSETDANGLAMKTPVSILQELLSRRGITPGYELVQIEG
AIHEPTFRFRVSFKDKDTPFTAMGAGRSKKEAKHAAARALIDKLIGAQLPESPSSSAGPSVTGLTVAGSGGDGNANATGG
GDASDKTVGNPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAAHRMWMRLQETP
IDSGKISDSICGELEGEKTCLKNNKIDYIKLLGEIATENQFEVTYVDIEEKTFSGQFQCLVQLSTLPVGVCHGSGPTAAD
AQRHAAQNALEYLKIMTKK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0080497
1879
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0080498
2017
FBtr0100220
2147
FBtr0303269
1334
FBtr0342632
1876
FBtr0342633
2014
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0080076
465
FBpp0099590
383
FBpp0292361
359
FBpp0309561
418
FBpp0309562
464
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG6866-PA
loqs-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)