Polypeptide Dmel\Lim3-PA

General Information
Symbol	Dmel\Lim3-PA	Species	D. melanogaster
Annotation Symbol	CG10699-PA	FlyBase ID	FBpp0080713
Associated gene	Dmel\Lim3

Length (aa)	440	Theoretical pI	8.06
Predicted MW (kDa)	49.0

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MELLKLMMFKSDFLSNGKCDDRVPPINLSQLPEFLLSTIPKCGGCHELIL DRFILKVLERTWHAKCLQCSECHGQLNDKCFARNGQLFCKEDFFKRYGTK CSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLMEDRKL ICKRDYEEAKAKGLYLDGSLDGDQPNKRPRTTITAKQLETLKTAYNNSPK PARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWSQYFRSM KGNCSPRTDKFLDKDELKVDYDSFSHHDLSNDSYSTVNLGLDEGASPHSI RGSYMHGSSSPSQYPPSSRSPPPVGQGHTFGSYPDNIVYTNIDQAVGSSL HASKAHHRLHSSNNVSDLSNDSSPDQGYPDFPPSPDSWLGDSGSTNTTSA NNNANNNSSSSHNNNNSSGGGSGGVSVSTAPNPSAPGVHY
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) Lim3-RA FBtr0081170 2578
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) Lim3-RB FBtr0081169 2680 Lim3-RC FBtr0309832 3001 Lim3-RD FBtr0309833 2709 Lim3-RE FBtr0309834 2188 Lim3-RF FBtr0309835 3643 Lim3-RG FBtr0329940 3001
Other Polypeptides
	Name FlyBase ID Length (aa) Lim3-PB FBpp0080712 520 Lim3-PC FBpp0301566 520 Lim3-PD FBpp0301567 520 Lim3-PE FBpp0301568 405 Lim3-PF FBpp0301569 520 Lim3-PG FBpp0302972 555
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_476606 DDBJ / EMBL / GenBank • AAF53756
Synonyms
	CG10699-PA Lim3-PA
References ( 2 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453] FlyBase, 1996-, FlyBase inference based on genome sequence analysis. FlyBase inference based on genome sequence analysis. [FBrf0104946]