A Database of Drosophila Genes & Genomes

FB2013_03, released May 7th, 2013
 

Polypeptide Dmel\CG31988-PA

General Information
Symbol Dmel\CG31988-PA Species D. melanogaster
Annotation Symbol CG31988-PA FlyBase ID FBpp0081018
Associated gene Dmel\CG31988
Length (aa) 178 Theoretical pI 7.22
Predicted MW (kDa) 20.2
Map ( GBrowse ) GBrowse View Help detailed view FBpp0291140 FBpp0081019 FBpp0081018
hide Recent Updates
Description
What does this section display?
This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms).
What does this section not display?
This section does not currently display links that were removed or gene model changes.
Update Feed
Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates Click here to see a list of all updates to this record from FB2010_08 and on.
hide Sequence
MTESIVCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSG
EPVCNKCFVERYTYTCAGCKKPILEKTICAMGESWHEDCFCCGGACKKPL
ANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITDSAVLAMNVKWHRDCF
RCNKCENPITSQTFTIDGDKPVCPACNC
hide Other Products of this Gene
Transcripts
Corresponding to
THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0081490
1047
hide External Crossreferences
RefSeq - An integrated, non-redundant set of sequences
hide Synonyms
CG31988-PA
 
hide References ( 2 )
FlyBase analysis
FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome.
Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453]
FlyBase, 1996-, FlyBase inference based on genome sequence analysis.
FlyBase inference based on genome sequence analysis. [FBrf0104946]