Polypeptide Dmel\Gr39a-PA

General Information
Symbol	Dmel\Gr39a-PA	Species	D. melanogaster
Annotation Symbol	CG31622-PA	FlyBase ID	FBpp0081039
Associated gene	Dmel\Gr39a

Length (aa)	371	Theoretical pI	9.25
Predicted MW (kDa)	42.4

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MSKVCRDLRIYLRLLHIMGMMCWHFDSDHCQLVATSGSERYAVVYAGCIL VSTTAGFIFALLHPSRFHIAIYNQTGNFYEAVIFRSTCVVLFLVYVILYA WRHRYRDLVQHILRLNRRCASSCTNQQFLHNIILYGMLTILCFGNYLHGY TRAGLATLPLALCMLVYIFAFLVLCLLLMFFVSLKQVMTAGLIHYNQQLC QGDLISGLRGRQQILKLCGGELNECFGLLMLPIVALVLLMAPSGPFFLIS TVLEGKFRPDECLIMLLTSSTWDTPWMIMLVLMLRTNGISEEANKTAKML TKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDKSTLFKLFTAIFT YMVILVQFKEMENSTKSINKF
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) Gr39a-RA FBtr0081511 1116
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) Gr39a-RB FBtr0081508 1119 Gr39a-RC FBtr0081509 1146 Gr39a-RD FBtr0081510 1146
Other Polypeptides
	Name FlyBase ID Length (aa) Gr39a-PB FBpp0081036 372 Gr39a-PC FBpp0081037 381 Gr39a-PD FBpp0081038 381
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_724332 DDBJ / EMBL / GenBank • AAN11117
Synonyms
	CG31622-PA Gr39a-PA
References ( 2 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453] FlyBase, 1996-, FlyBase inference based on genome sequence analysis. FlyBase inference based on genome sequence analysis. [FBrf0104946]