Open Close
General Information
Symbol
Dmel\pum-PB
Species
D. melanogaster
Annotation Symbol
CG9755-PB
FlyBase ID
FBpp0081473
Associated gene
Length (aa)
1185
Theoretical pI
7.32
Predicted MW (kDa)
123.5
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MMKLLHDFILDARTAEDVALTQEMITTSTAKKLWEKSDGKGVSSSTPGGPLHPLQIPGIGDPSSVWKDHTWSTQGENILV
PPPSRAYAHGGASDTSNSGNAGILSPRDSTCAKVVEYVFSGSPTNKDSSLSGLEPHLRNLKFDDNDKSRDDKEKANSPFD
TNGLKKDDQVTNSNGVVNGIDDDKGFNRTPGSRQPSPAEESQPRPPNLLFPPLPFNHMLMDHGQGMGGGLGGVVGSGNGV
GGGSGGGGAGGAYAAHQQMAAQMSQLQPPMMNGVGGGMPMAAQSPMLNHQAAGPNHMESPGNLLQQQNFDVQQLFRSQNP
GLAAVATNAAAAAAAAAAATSAASAAAAVGAPPVPNGSLQQSQQQQQQQQQQQQQQQMHMAAASQQFLAAQQQAQNAAYA
AQQATSYVINPGQEAAPYMGMIAAAQMPYYGVAPWGMYPGNLIPQQGTQPRRPLTPSQQGAENQPYQVIPAFLDHTGSLL
MGGPRTGTPMRLVSPAPVLVPPGATRAGPPPPQGPQLYQPQPQTAQQNLYSQQNGSSVGGLALNTSSLTGRRDSFDRSTS
AFSPSTMDYTSSGVAAAANAVNSTVAQAAAAAAAAAAARGKWPGAMSGAASGAYGALGAGNASASPLGAPITPPPSAQSC
LLGSRAPGAESRQRQQQQQQLAAVGLPATAAAAQAAVAAAANNMFGSNSSIFSNPLAIPGTAAVAAAAAAAAAANSRQVA
ATAAAAAAVAAAAGGVGGAPQPGRSRLLEDFRNQRYPNLQLRDLANHIVEFSQDQHGSRFIQQKLERATAAEKQMVFSEI
LAAAYSLMTDVFGNYVIQKFFEFGTPEQKNTLGMQVKGHVLQLALQMYGCRVIQKALESISPEQQQEIVHELDGHVLKCV
KDQNGNHVVQKCIECVDPVALQFIINAFKGQVYSLSTHPYGCRVIQRILEHCTAEQTTPILDELHEHTEQLIQDQYGNYV
IQHVLEHGKQEDKSILINSVRGKVLVLSQHKFASNVVEKCVTHATRGERTGLIDEVCTFNDNALHVMMKDQYANYVVQKM
IDVSEPTQLKKLMTKIRPHMAALRKYTYGKHINAKLEKYYMKITNPITVGTGAGGVPAASSAAAVSSGATSASVTACTSG
SSTTTTSTTNSLASPTICSVQENGSAMVVEPSSPDASESSSSVVSGAVNSSLGPIGPPTNGNVVL
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0081993
7473
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0081990
6661
FBtr0081992
6809
FBtr0081991
6659
FBtr0081994
4685
FBtr0305197
4655
FBtr0333667
10223
FBtr0333668
8057
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0081470
1533
FBpp0081472
1533
FBpp0081471
1533
FBpp0081474
935
FBpp0293727
925
FBpp0305823
1533
FBpp0305824
921
External Crossreferences and Linkouts ( 4 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG9755-PB
Name Synonyms
Secondary FlyBase IDs
    References (2)